-
M414282-50mg
MLN-4760 (C007B-231133)
Price: $1,410.69List Price: $1,567.43ACE2 (Cell-free assay): CPDA (Cell-free assay) 0.44 nM: 27 μMIn vitroconversion from angiotensin II to angiotensin-(1–7) by mouse ACE2 is blocked by MLN-4760 (10 μM). MLN-4760 inhibits both human and mouse ACE2 activity. In huMNCs, MLN-4760-B (an -
M414282-5mg
MLN-4760 (C007B-231134)
Price: $404.43List Price: $449.37ACE2 (Cell-free assay): CPDA (Cell-free assay) 0.44 nM: 27 μMIn vitroconversion from angiotensin II to angiotensin-(1–7) by mouse ACE2 is blocked by MLN-4760 (10 μM). MLN-4760 inhibits both human and mouse ACE2 activity. In huMNCs, MLN-4760-B (an -
EK730131
Mouse Endothelial nitric oxide synthase 3,eNOS-3 Elisa Kit
Price: $710.02List Price: $788.91Species : Mouse Assay Principle : Quantitative Target Name : Endothelial nitric oxide synthase 3,eNOS-3 Sensitivity : 0.08 ng/mL Detection Range : 0.3 ng/mL -20 ng/mL -
F7131-100MG
N-(3-(2-FURYL)ACRYLOYL)-PHE-GLY-GLY (C005B-055426)
Price: $584.62List Price: $649.58Amino Acid Sequence FA-Phe-Gly-Gly General description N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly acts as a substrate for angiotensin converting enzyme (ACE), and is used in inhibitory assays of ACE. Application N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly has -
F7131-25MG
N-(3-(2-FURYL)ACRYLOYL)-PHE-GLY-GLY (C005B-055427)
Price: $194.78List Price: $216.43Amino Acid Sequence FA-Phe-Gly-Gly General description N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly acts as a substrate for angiotensin converting enzyme (ACE), and is used in inhibitory assays of ACE. Application N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly has -
F7131-500MG
N-(3-(2-FURYL)ACRYLOYL)-PHE-GLY-GLY (C005B-055428)
Price: $1,867.36List Price: $2,074.84Amino Acid Sequence FA-Phe-Gly-Gly General description N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly acts as a substrate for angiotensin converting enzyme (ACE), and is used in inhibitory assays of ACE. Application N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly has -
N135249-100mg
N-[3-(2-Furyl)acryloyl]-L-phenylalanyl-glycyl-glycine (C007B-238925)
Price: $319.69List Price: $355.21N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly, substrate for the continuous spectrophotometric assay of ACE (angiotensin converting enzyme). Amino Acid Sequence: FA-Phe-Gly-Gly.A substrate for the continuous sprectrophotometric assay of ACE. -
N135249-25mg
N-[3-(2-Furyl)acryloyl]-L-phenylalanyl-glycyl-glycine (C007B-238926)
Price: $115.79List Price: $128.65N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly, substrate for the continuous spectrophotometric assay of ACE (angiotensin converting enzyme). Amino Acid Sequence: FA-Phe-Gly-Gly.A substrate for the continuous sprectrophotometric assay of ACE. -
N135249-500mg
N-[3-(2-Furyl)acryloyl]-L-phenylalanyl-glycyl-glycine (C007B-238927)
Price: $814.74List Price: $905.27N-[3-(2-Furyl)acryloyl]-Phe-Gly-Gly, substrate for the continuous spectrophotometric assay of ACE (angiotensin converting enzyme). Amino Acid Sequence: FA-Phe-Gly-Gly.A substrate for the continuous sprectrophotometric assay of ACE. -
N658979-10mg
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ (C007B-379316)
Price: $1,734.20List Price: $1,926.89NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.Appearance:SolidBiological Activity:NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an -
N658979-5mg
NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ (C007B-379317)
Price: $998.39List Price: $1,109.32NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an angiotensin-converting enzyme 2 (ACE2) related peptide that can be used as a tool for understanding ACE2 functions.Appearance:SolidBiological Activity:NMNNAGDKWSAFLKEQSTLAQMYPLQEIQNLTVKLQLQALQQ is an -
EK751019
Porcine Endothelial nitric oxide synthase 3,eNOS-3 Elisa Kit
Price: $710.02List Price: $788.91Species : Porcine Assay Principle : Quantitative Target Name : Endothelial nitric oxide synthase 3,eNOS-3 Sensitivity : 0.8 pg/ml Detection Range : 3.3 pg/ml -200 pg/ml