Eukaryotic Cells

Anti-CWF19L2 CWF19-like 2, cell cycle control (S. pombe), 10

Immunogen Recombinant protein corresponding to D-2-hydroxyglutarate dehydrogenase Sequence VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVS Application All Prestige Antibodies Powered by Atlas Antibodies are

Dachsous cadherin-related 1 (DCHS1) is the mammalian homologue of the dachsous gene in Drosophila. It has 27 cadherin domains and the gene encoding it is localized on human chromosome 11.

General description Desert Hedgehog (DHH) is one of three signaling molecules belonging to the hedgehog family, a group of intracellular signaling molecules characterized for their regulatory ability in developmental tissue patterning. DHH is an

Anti-DLG5 discs, large homolog 5 (Drosophila), 100ul UN 1687

Anti-EIF2D eukaryotic translation initiation factor 2D, 100u

Anti-EIF3J eukaryotic translation initiation factor 3, subun

Anti-EIF3J eukaryotic translation initiation factor 3, subun

Anti-EIF4A2 eukaryotic translation initiation factor 4A2, 10

Ectoplasmic specialization protein (ESPN) is present in parallel actin bundles in ear hair cells. ESPN gene is located on human chromosome 1p36.

The gene electron transfer flavoprotein subunit &#945 (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria.

The gene electron transfer flavoprotein subunit &#945 (ETFA) is mapped to human chromosome 15q23. The protein localizes in the mitochondria.