Established Human Mutant Cell Lines

General description Chromosomal segregation during mitosis as well as meiosis is regulated by kinases and phosphatases. The Aurora kinases, members of the Ser/Thr protein kinase family, associate with microtubules during chromosome movement and

Immunogen biogenesis of lysosomal organelles complex-1, subunit 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen biogenesis of lysosomal organelles complex 1 subunit 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

General description The protein encoded by this gene is highly similar to Saccharomyces cerevisiae Cdc6, a protein essential for the initiation of DNA replication. This protein functions as a regulator at the early steps of DNA replication.

General description The protein encoded by this gene is a bZIP transcription factor which can bind as a homodimer to certain DNA regulatory regions. It can also form heterodimers with the related protein CEBP-delta.

Specificity MAB2115 recognizes a 70 kDa surface protein in about 100% nucleated erythroid cells (erythroblasts, normoblasts, proerythroblasts), 36% of late erythroid committed cells and 70-80% of fetal liver cells. Normal stem cells, early

Cadherin EGF LAG seven-pass G-type receptor 3 (CELSR3) is also called multiple epidermal growth factor (EGF)-like domains protein 2 (MEGF2). It has transmembrane regions, six EGF-like domains, eight cadherin motifs and two laminin G domains.

Anti-CWF19L1 CWF19-like 1, cell cycle control (S. pombe), 10

Anti-CWF19L1 CWF19-like 1, cell cycle control (S. pombe), 10

Anti-CWF19L2 CWF19-like 2, cell cycle control (S. pombe), 10

Immunogen Recombinant protein corresponding to D-2-hydroxyglutarate dehydrogenase Sequence VTDPEALQAPNVDWLRTLRGCSKVLLRPRTSEEVSHILRHCHERNLAVNPQGGNTGMVGGSVPVFDEIILSTARMNRVLSFHSVS Application All Prestige Antibodies Powered by Atlas Antibodies are

Dachsous cadherin-related 1 (DCHS1) is the mammalian homologue of the dachsous gene in Drosophila. It has 27 cadherin domains and the gene encoding it is localized on human chromosome 11.