Beta-2-glycoprotein iii immunological test system

General description Extracellular domain of human RANK (CD265). Application Epitope: extracellular domain Quality Evaluated by Western Blotting in K562 cell lysates.

Anti-CD2AP CD2-associated protein, 100ul UN 1687 6.1 PG2

General description The antibody detects endogenous level of total CD3E protein. Immunogen Peptide sequence around aa.

Immunogen choline O-acetyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to cysteine rich hydrophobic domain 2 Sequence MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen cytokine inducible SH2-containing protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CAP-Gly domain containing linker protein 2 (CLIP2) possesses a structural maintenance of chromosomes (Smc) domain. The gene encoding this protein is localized on human chromosome 7q11.

Immunogen component of oligomeric golgi complex 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

COLGALT1 (collagen &#946(1- O )galactosyltransferase 1), which is also known as GLT25D1 (glycosyltransferase 25 domain 1), is a soluble protein located in the ER (endoplasmic reticulum). It belongs to GT25 family, that encodes glycosyltransferase.

Immunogen coatomer protein complex, subunit beta 2 (beta prime) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen carboxypeptidase A1 (pancreatic) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to crystallin beta A2 Sequence GYQYVLERDRHSGEFCTYGELGTQAHTGQLQSIRRVQH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project