-
Add to Cart The item has been addedHPA067853-100ULANTI-AMOT (C005B-220624)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to angiomotin Sequence PFKGMPPQSVVCKPQEPGHFYSEHRLNQPGRTEGQLMRYQHPPEYGAARPAQDISLPLSARNSQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA038662-100ULANTI-AMPD3 (C005B-210892)
Price: $1,013.20List Price: $1,125.78Immunogen adenosine monophosphate deaminase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA039801-100ULANTI-ANAPC5 (C005B-211407)
Price: $1,013.20List Price: $1,125.78Immunogen anaphase promoting complex subunit 5 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA038516-100ULANTI-ANGPTL5 (C005B-210816)
Price: $1,013.20List Price: $1,125.78Immunogen angiopoietin-like 5 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA004625-100ULANTI-ANPEP ANTIBODY PRODUCED IN RABBIT
Price: $959.88List Price: $1,066.53Immunogen alanyl (membrane) aminopeptidase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA066782-100ULANTI-AP1S3 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen adaptor-related protein complex 1, sigma 3 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA045458-100ULANTI-AP3B1 (C005B-213947)
Price: $1,013.20List Price: $1,125.78Immunogen adaptor-related protein complex 3, beta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA074408-100ULANTI-AP3D1 (C005B-221770)
Price: $1,013.20List Price: $1,125.78Immunogen adaptor-related protein complex 3, delta 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA021188-100ULANTI-APIP (C005B-205537)
Price: $959.88List Price: $1,066.53The gene APIP (APAF1-interacting protein) is mapped to human chromosome 11p13. Immunogen APAF1 interacting protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
Add to Cart The item has been addedHPA065365-100ULANTI-APOC3 (C005B-220128)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to apolipoprotein C3 Sequence ASEAEDASLLSFMQGYMKHATKTAKDA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA055647-100ULANTI-AQR (C005B-217403)
Price: $1,013.20List Price: $1,125.78Immunogen aquarius intron-binding spliceosomal factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA055184-100ULANTI-ARHGAP35 ANTIBODY PRODUCED IN RABBIT (C005B-217248)
Price: $1,013.20List Price: $1,125.78Immunogen Rho GTPase activating protein 35 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in
