-
Add to Cart The item has been addedHPA026478-100ULANTI-AMPD1 (C005B-206767)
Price: $959.88List Price: $1,066.53The AMPD1 gene is mapped to human chromosome 1p13.2. -
Add to Cart The item has been addedHPA019206-100ULANTI-AQP1 (C005B-205034)
Price: $959.88List Price: $1,066.53The gene AQP1 (aquaporin-1) is mapped to human chromosome 7p14. It is an integral membrane protein. -
Add to Cart The item has been addedHPA051019-100ULANTI-ARFGAP1 ANTIBODY PRODUCED IN RABBIT (C005B-215861)
Price: $1,013.20List Price: $1,125.78Immunogen ADP-ribosylation factor GTPase activating protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
Add to Cart The item has been addedHPA066481-100ULANTI-ARHGAP11A ANTIBODY PRODUCED IN RABBIT (C005B-220338)
Price: $1,066.53List Price: $1,185.03Immunogen Rho GTPase activating protein 11A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA035777-100ULANTI-ARHGAP19 (C005B-209581)
Price: $1,013.20List Price: $1,125.78Immunogen Rho GTPase activating protein 19 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA078260-100ULANTI-ARHGDIG (C005B-222353)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to Rho GDP dissociation inhibitor gamma Sequence DKEGGPPAVDEVLDEAVPEYRAPGRKSLLEIRQLDPDDRSLAKYKRVLLGPLPPAVDPSLPNV Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated -
Add to Cart The item has been addedHPA003295-100ULANTI-ARIH1 (C005B-201912)
Price: $959.88List Price: $1,066.53Immunogen Protein ariadne-1 homolog recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA023245-100ULANTI-ARSG (C005B-206036)
Price: $959.88List Price: $1,066.53The gene ARSG (arylsulfatase G) is mapped to human chromosome 17q24. It is a lysosomal sulfatase and is widely expressed. -
Add to Cart The item has been addedHPA023285-100ULANTI-ARSG (C005B-206059)
Price: $959.88List Price: $1,066.53The gene ARSG (arylsulfatase G) is mapped to human chromosome 17q24. It is a lysosomal sulfatase and is widely expressed. -
Add to Cart The item has been addedHPA026749-100ULANTI-ASPSCR1 (C005B-206876)
Price: $959.88List Price: $1,066.53Alveolar soft part sarcoma chromosomal region candidate 1 (ASPSCR1) gene is mapped to human chromosome 17q25. ASPSCR1, also known as alveolar soft part sarcoma locus (ASPL) or TUG (tether, containing a UBX domain, for GLUT4) codes for a member of -
Add to Cart The item has been addedHPA035583-100ULANTI-ATP11A (C005B-209501)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, class VI, type 11A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA035584-100ULANTI-ATP11A (C005B-209502)
Price: $1,013.20List Price: $1,125.78Immunogen ATPase, class VI, type 11A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
