-
Add to Cart The item has been addedHPA054864-100ULANTI-DTWD2 (C005B-217149)
Price: $1,013.20List Price: $1,125.78Immunogen DTW domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA041578-100ULANTI-DUOXA1 (C005B-212249)
Price: $1,013.20List Price: $1,125.78Immunogen dual oxidase maturation factor 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA062905-100ULANTI-DYNC2LI1 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen dynein, cytoplasmic 2, light intermediate chain 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA035347-100ULANTI-ECM2 (C005B-209401)
Price: $1,013.20List Price: $1,125.78Immunogen extracellular matrix protein 2, female organ and adipocyte specific recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas -
Add to Cart The item has been addedHPA067567-100ULANTI-EFNA2 (C005B-220576)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to ephrin A2 Sequence PGHEYYYISATPPNAVDRPCLRLKVYVRPTNETLYEAPEPIFTSNNSCSSPGGCRLFLSTIPVLWTLLG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
Add to Cart The item has been addedHPA064370-100ULANTI-EIF2B5 (C005B-219866)
Price: $1,013.20List Price: $1,125.78Immunogen eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA069303-100ULANTI-EIF2B5 (C005B-220878)
Price: $1,013.20List Price: $1,125.78Immunogen eukaryotic translation initiation factor 2B, subunit 5 epsilon, 82kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA064885-100ULANTI-EIF2S1 ANTIBODY PRODUCED IN RABBIT (C005B-220018)
Price: $1,013.20List Price: $1,125.78Immunogen eukaryotic translation initiation factor 2, subunit 1 alpha, 35kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedHPA063001-100ULANTI-ELAVL2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen ELAV like neuron-specific RNA binding protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA022838-100ULANTI-EMC2
Price: $959.88List Price: $1,066.53EMC2 (ER membrane protein complex subunit 2) is a 󕾘kDa novel non-membrane-spanning protein. The study shows that EMC2 may possess a novel putative O-linked glycosyl transferase. -
Add to Cart The item has been addedHPA045646-100ULANTI-EN2 (C005B-214017)
Price: $1,013.20List Price: $1,125.78Immunogen engrailed homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA069809-100ULANTI-EN2 (C005B-220985)
Price: $1,013.20List Price: $1,125.78Immunogen engrailed homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
