-
Add to Cart The item has been addedHPA053128-100ULANTI-AHCYL2 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Immunogen adenosylhomocysteinase-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA028961-100ULANTI-AIFM2 (C005B-207724)
Price: $959.88List Price: $1,066.53Immunogen apoptosis-inducing factor, mitochondrion-associated, 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA031365-100ULANTI-AIM2 (C005B-208701)
Price: $970.54List Price: $1,078.38Immunogen absent in melanoma 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA018479-100ULANTI-AK2 (C005B-204824)
Price: $959.88List Price: $1,066.53The gene AK2 (adenylate kinase 2 - mitochondrial) is mapped to human chromosome 1p34. AK2 is expressed in a variety of tissues including liver, kidney, spleen and heart. -
Add to Cart The item has been addedHPA017919-100ULANTI-AKR1A1 (C005B-204647)
Price: $959.88List Price: $1,066.53Aldo-keto reductase family 1 member A1 (AKR1A1) belongs to the aldo-keto reductase superfamily, and is expressed in the liver and kidney. The gene encoding it is localized on human chromosome 1p32-p33. -
Add to Cart The item has been addedHPA037822-100ULANTI-AKR1E2 (C005B-210464)
Price: $1,013.20List Price: $1,125.78Immunogen aldo-keto reductase family 1, member E2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA059282-100ULANTI-ALDH1L2 (C005B-218488)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to aldehyde dehydrogenase 1 family member L2 Sequence KCGGLQLQNEDVYMATKFEGFIQKVVRKLRGEDQEVELVVDYISKEVNEIMVKMPYQCFINGQFTDADDGKT Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedHPA026292-100ULANTI-ALDH8A1 (C005B-206731)
Price: $959.88List Price: $1,066.53The gene encoding aldehyde dehydrogenase 8 family member A1 (ALDH8A1) is localized on human chromosome 6q23. The ALDH8A1 mRNA is expressed in the liver and kidneys. -
Add to Cart The item has been addedHPA043200-100ULANTI-ALMS1 (C005B-213023)
Price: $1,013.20List Price: $1,125.78Immunogen Alstrom syndrome 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
Add to Cart The item has been addedHPA027137-100ULANTI-AMPD2 ANTIBODY PRODUCED IN RABBIT (C005B-207020)
Price: $959.88List Price: $1,066.53Immunogen adenosine monophosphate deaminase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedHPA045760-100ULANTI-AMPD2 ANTIBODY PRODUCED IN RABBIT (C005B-214054)
Price: $1,013.20List Price: $1,125.78Adenosine monophosphate deaminase 2 (AMPD2) is made up of nineteen exons and eighteen intervening sequences. It is expressed in nonmuscle tissues and cells. -
Add to Cart The item has been addedHPA050590-100ULANTI-AMPD2 ANTIBODY PRODUCED IN RABBIT (C005B-215730)
Price: $1,013.20List Price: $1,125.78Immunogen adenosine monophosphate deaminase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,
