Cancer antigen 242 tests

Immunogen RNA-binding protein 12B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen RNA binding motif, single stranded interacting protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Immunogen RNA-binding motif protein, X-linked 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen RNA binding motif protein, X-linked-like 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen regulator of chromosome condensation (RCC1) and BTB (POZ) domain containing protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

Immunogen Recombinant protein corresponding to ral guanine nucleotide dissociation stimulator like 2 Sequence FDKRRKEFAVLSELRRLQNECRGYNLQPDHDIQRWLQGLRPLTEAQSHRVSCEVEPPGSSDPPAPRVLRPTLVISQWA Application All Prestige Antibodies Powered by Atlas

Mitochondrial Rho GTPase 2 (RHOT2) is a GTPase having a carboxyl-terminal transmembrane domain and GTP-binding domains which are separated by a linker region containing calcium-binding motifs. RHOT2 is commonly referred as MIRO2.

Immunogen Receptor-interacting serine/threonine-protein kinase 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Protein XRP2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Replication protein A2 (RPA2) is a 32kDa protein. The gene encoding it is localized on human chromosome 1p35.

Replication protein A2 (RPA2) is a 32kDa protein. The gene encoding it is localized on human chromosome 1p35.

Immunogen REM2 and RAB-like small GTPase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in