Cancer antigen 242 tests

Immunogen sperm flagellar 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the

Immunogen Spindlin-2B recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen sparc/osteonectin, cwcv and kazal-like domains proteoglycan (testican) 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen Signal peptide peptidase-like 2A (Protein SPP-like 2A) (Protein SPPL2a) (Intramembrane protease 3) (IMP-3) (Presenilin-like protein 2) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas

Immunogen Recombinant protein corresponding to sprouty related EVH1 domain containing 2 Sequence EGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTLGHLHDSYPTDHYHLDQPMP Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Recombinant protein corresponding to splA/ryanodine receptor domain and SOCS box containing 4 Sequence QKLSGSLKSVEVREPALRPAKRELRGAEPGRPARLDQLLDMPAAGLAVQLRH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen sulfide quinone reductase-like (yeast) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Sulfide:quinone oxidoreductase, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project

Immunogen Recombinant protein corresponding to sequestosome 1 Sequence HGGKRSRLTPVSPESSSTEEKSSSQPSSCCSDPSKPGGNVEGATQSLAEQMRKIALESEGRPEEQMESDNCSGGDDDWTHLSSK Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen sushi-repeat-containing protein, X-linked 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen serine/arginine repetitive matrix 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Immunogen Recombinant protein corresponding to single stranded DNA binding protein 2 Sequence LGPQSDPWLSLQNYGGAMRPPLNALGGPGMPGMNMGPGGGR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein