Cancer antigen 242 tests

Immunogen Recombinant protein corresponding to atlastin GTPase 2 Sequence RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

The gene encoding plasma membrane calcium-transporting ATPase 1 (ATP2B1) is located on chromosome 12q21-q23. It is localized to the basolateral membrane of cells and expressed widely in many tissues.

Immunogen ATPase, Ca++ transporting, type 2C, member 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen ATPase, Ca++ transporting, type 2C, member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

BCL2 associated athanogene 1 (BAG1) is an anti-apoptotic protein and the gene expressing it is localized on human chromosome 9. Immunogen BAG family molecular chaperone regulator 1 recombinant protein epitope signature tag (PrEST) Application All

Immunogen BAI1-associated protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Brain-specific angiogenesis inhibitor 1-associated protein 2-like protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen BARX homeobox 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Polyclonal antibody for Bcl-2/BCL2 detection. Host: Rabbit.

Immunogen BCL2-like 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen BEN domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Breast cancer susceptibility gene 2 (BRCA2) is mapped to human chromosome 13q12-q13. The protein encoded by this gene is characterized with BRC repeats in exon 11 and a highly conserved radiation sensitive protein 51 (RAD51) binding domain in exon