Cancer antigen 242 tests

CCDC51 (Coiled-coil domain-containing protein 51) is an uncharacterized coiled-coil domain protein belonging to the evolutionarily conserved coiled-coil domain-containing protein family. Generally, it plays a role in the homodimerization and helps

Cyclin A2 (CCNA2) is part of the cyclin family and is localizes in the nucleus. The gene encoding it is localized on human chromosome 4q27.

CD2AP (CD2-associated protein) gene encodes a saffolding protein. It consist of three consecutive SH3 domains at the N terminus followed by a proline-rich domain, a coiled-coiled domain and a monomeric actin binding domain at the C-terminus.

Immunogen CD48 molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Recombinant protein corresponding to cell division cycle 42 Sequence NVFDEAILAALEPPETQPKRKCCIF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen CDC42 effector protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen CDC42 small effector 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen CDC42 small effector 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Cell division cycle associated 2 (CDCA2) is expressed in the nucleus. The gene encoding it is localized on human chromosome 8p21.

Immunogen Recombinant protein corresponding to cysteine rich hydrophobic domain 2 Sequence DFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVR Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen cytoplasmic linker associated protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen C-type lectin domain family 2, member L recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a