-
Add to Cart The item has been addedHPA041829-100ULANTI-CUEDC2 (C005B-212382)
Price: $1,055.86List Price: $1,173.18Immunogen CUE domain containing 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA031999-100ULANTI-CXCR2 ANTIBODY PRODUCED IN RABBIT
Price: $970.54List Price: $1,078.38Immunogen chemokine (C-X-C motif) receptor 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA013547-100ULANTI-CYP2C8 (C005B-203831)
Price: $959.88List Price: $1,066.53CYP2C8 (cytochrome P450, family 2, subfamily C, polypeptide 8) has been found to be expressed in the kidney, adrenal gland, brain, uterus, mammary gland, ovary, and duodenum. The gene is mapped to human chromosome 10q23. -
Add to Cart The item has been addedHPA009128-100ULANTI-CYP2E1 (C005B-203194)
Price: $1,066.53List Price: $1,185.03The CYP2E1 (cytochrome P450 2E1) gene is mapped to human chromosome 10 and is polymorphic. CYP2E1 is part of the cytochrome P450 (CYP) family of enzymes. -
Add to Cart The item has been addedHPA029564-100ULANTI-CYP2E1 (C005B-207963)
Price: $959.88List Price: $1,066.53The gene CYP2E1 (cytochrome P450 2E1) is mapped to human chromosome 10. The CYP2E1 gene is polymorphic. -
Add to Cart The item has been addedHPA049227-100ULANTI-CYP2S1 (C005B-215249)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome P450, family 2, subfamily S, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA064827-100ULANTI-CYP2U1 (C005B-219997)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome P450, family 2, subfamily U, polypeptide 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA012753-100ULANTI-CYP2W1 (C005B-203709)
Price: $959.88List Price: $1,066.53Cytochrome P450 2W1 (CYP2W1) is a hemoprotein which belongs to the cytochrome family of proteins. It is located on the cell surface. -
Add to Cart The item has been addedHPA058960-100ULANTI-CYP4F2 ANTIBODY PRODUCED IN RABBIT (C005B-218391)
Price: $1,013.20List Price: $1,125.78Immunogen cytochrome P450, family 4, subfamily F, polypeptide 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
Add to Cart The item has been addedHPA060662-100ULANTI-CYTH2 (C005B-218874)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to cytohesin 2 Sequence REELSEAMSEVEGLEANEGSKTLQRNRKMAMGRKKF Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA026506-100ULANTI-DARS2 (C005B-206779)
Price: $959.88List Price: $1,066.53Aspartyl-tRNA synthetase 2, mitochondrial (DARS2) is a homodimeric enzyme. The gene encoding it is localized on human chromosome 1q25. -
Add to Cart The item has been addedHPA026528-100ULANTI-DARS2 (C005B-206787)
Price: $959.88List Price: $1,066.53Aspartyl-tRNA synthetase 2, mitochondrial (DARS2) is a homodimeric enzyme. The gene encoding it is localized on human chromosome 1q25.
