-
Add to Cart The item has been addedHPA065713-100ULANTI-TTC39C ANTIBODY PRODUCED IN RABBIT (C005B-220197)
Price: $1,013.20List Price: $1,125.78Immunogen tetratricopeptide repeat domain 39C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA065705-100ULANTI-TTC39C (C005B-220193)
Price: $1,013.20List Price: $1,125.78Immunogen tetratricopeptide repeat domain 39C Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA065062-100ULANTI-ZC2HC1C
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to zinc finger C2HC-type containing 1C Sequence SRNFGVRNQGNFSVVGTVLAATQAEKAVANFDRTEWVQIRRLEAAGESLEEEIRRKQILLRGKLKKTEEELRRIQTQK Application All Prestige Antibodies Powered by Atlas Antibodies are developed -
Add to Cart The item has been addedCL055F-5AntiRat NK cells(NKR-P1)FITC(Clone 10-78,Mse IgG1)500ug
Price: $1,095.44List Price: $1,217.15AntiRat NK cells(NKR-P1)FITC(Clone 10-78,Mse IgG1)500ug -
Add to Cart The item has been addedAb094343-100μgCD27 Rat mAb (C007B-504735)
Price: $190.21List Price: $211.35Rat anti Mouse CD27 Antibody, Monoclonal (RM27-3E5), could be used for Flow, IP, in vivo CD27 stimulation, in vitro CD27 stimulation and so on.ApplicationFlow: Use at an assay dependent concentration.IP: Use at an assay dependent concentration.in -
Add to Cart The item has been addedAb094343-10μgCD27 Rat mAb (C007B-504736)
Price: $59.80List Price: $66.44Rat anti Mouse CD27 Antibody, Monoclonal (RM27-3E5), could be used for Flow, IP, in vivo CD27 stimulation, in vitro CD27 stimulation and so on.ApplicationFlow: Use at an assay dependent concentration.IP: Use at an assay dependent concentration.in -
Add to Cart The item has been addedAb094343-1mgCD27 Rat mAb (C007B-504737)
Price: $972.85List Price: $1,080.95Rat anti Mouse CD27 Antibody, Monoclonal (RM27-3E5), could be used for Flow, IP, in vivo CD27 stimulation, in vitro CD27 stimulation and so on.ApplicationFlow: Use at an assay dependent concentration.IP: Use at an assay dependent concentration.in -
Add to Cart The item has been addedAb094343-50μgCD27 Rat mAb (C007B-504738)
Price: $138.29List Price: $153.65Rat anti Mouse CD27 Antibody, Monoclonal (RM27-3E5), could be used for Flow, IP, in vivo CD27 stimulation, in vitro CD27 stimulation and so on.ApplicationFlow: Use at an assay dependent concentration.IP: Use at an assay dependent concentration.in -
Add to Cart The item has been added607160CELLSTAR Serological Pipette, PS, 10mL, Plastic/Plastic Single Wrapped, Sterile, 1/10 Graduations, Orange Color Code
Price: $180.43List Price: $200.47With CELLSTAR®, Greiner Bio-One offers a comprehensive range of different serological pipettes with sophisticated features. Our use of high-quality polystyrene ensures maximum transparency, with the standardized color code allowing the volume to be -
Add to Cart The item has been added96020749-1VLCOR-L64 (C005B-238374)
Price: $1,835.55List Price: $2,039.50Cell Line Origin Human bone marrow, small cell lung carcinoma patient Cell Line Description COR-L64 is a B-lymphoblastoid cell line derived from a bone marrow trephine of the posterior iliac crest taken from a patient diagnosed with small cell lung -
Add to Cart The item has been addedC647428-10mgCSF1R-IN-1 (C007B-342552)
Price: $544.03List Price: $604.47CSF1R-IN-1 is a CSF1R inhibitor with an with an IC 50 of 0.5 nM.In VitroCSF1R is thought to play an important role in recruitment and differentiation of tumor-associated macrophages (TAMs). CSF1R-IN-1 (compound 22) shows good intestinal permeability -
Add to Cart The item has been addedC647428-1mgCSF1R-IN-1 (C007B-342553)
Price: $199.68List Price: $221.86CSF1R-IN-1 is a CSF1R inhibitor with an with an IC 50 of 0.5 nM.In VitroCSF1R is thought to play an important role in recruitment and differentiation of tumor-associated macrophages (TAMs). CSF1R-IN-1 (compound 22) shows good intestinal permeability
