Early prostate cancer antigen - 2 tests

Immunogen acid phosphatase, prostate Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

General description The inhibin alpha subunit joins either the beta A or beta B subunit to form a pituitary FSH secretion inhibitor. Inhibin has been shown to regulate gonadal stromal cell proliferation negatively and to have tumour-suppressor

Immunogen Prostate-specific antigen precursor recombinant protein epitope signature tag (PrEST) Application Anti-KLK3 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each

Immunogen microseminoprotein, prostate associated recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

General description Anti-OR51E2 Antibody detects endogenous levels of total OR51E2 protein. OR51E2 (olfactory receptor family 51 subfamily E member 2),also known as PSGR, codes for a G-protein–coupled receptor.

General description The product of this gene belongs to the family of G-protein coupled receptors. This family has several receptor subtypes with different pharmacological selectivity, which overlaps in some cases, for various adenosine and

Immunogen P antigen family, member 3 (prostate associated) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen prostate androgen-regulated mucin-like protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as

Immunogen Recombinant protein corresponding to prostate and testis expressed 1 Sequence LSGSLSMRNDAVNEIVAVKNNFPVIEIVRCRMCHLQFPGEKCSRGRGICTATTEE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Anti-PATE1 prostate and testis expressed 1, 100ul UN 1687 6.

Anti-PATE1 prostate and testis expressed 1, 25ul UN 1687 6.1

Immunogen prostate and testis expressed 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are