Gum allergenic extracts

Immunogen Synthetic peptide directed towards the N terminal region of human Sox10 Sequence Synthetic peptide located within the following region: MLWESKGLHIQTSRTGSPFQGEEEPFMEPSAAAQSVSAVQPGCLVVRIQA Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human SOX9 Application Anti-SOX9 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5 &#956g/ml.

Immunogen Synthetic peptide directed towards the C terminal region of human TAPBP Application Anti-TAPBP antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml and for immunohistochemistry of

General description Tryptase is the most abundant secretory granule-derived serine proteinase contained in mast cells. Tryptase has recently been used as a marker for mast cell activation and is involved with allergic response.

General description Purified mouse monoclonal antibody. Recognizes the ~125 kDa ULK1 protein.

General description VEGF (Vascular endothelial growth factor, VEGFA, VEGF-A), a dimeric ligand, is among the most potent angiogenic mitogens. VEGF is secreted by tumor cells and other cells exposed to hypoxia.

This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the Authority of the

Mouse anti Human Cystatin SN/CST1 Antibody, Monoclonal (C1), could be used for WB and so on.Application:WB: 0.01-2 µg/mL:Protein Function:Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to

Mouse anti Human Cystatin SN/CST1 Antibody, Monoclonal (C1), could be used for WB and so on.Application:WB: 0.01-2 µg/mL:Protein Function:Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to

Mouse anti Human Cystatin SN/CST1 Antibody, Monoclonal (C1), could be used for WB and so on.Application:WB: 0.01-2 µg/mL:Protein Function:Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to

Mouse anti Human Cystatin SN/CST1 Antibody, Monoclonal (C1), could be used for WB and so on.Application:WB: 0.01-2 µg/mL:Protein Function:Human saliva appears to contain several cysteine proteinase inhibitors that are immunologically related to

General description This product is provided as delivered and specified by the issuing Pharmacopoeia. All information provided in support of this product, including SDS and any product information leaflets have been developed and issued under the