-
Add to Cart The item has been addedAB1284ANTI-HEME OXYGENASE 1 ANTIBODY (C005B-239542)
Price: $855.02List Price: $950.02Specificity Recognizes Heme oxygenase-1. Immunogen A synthetic peptide with the amino acid sequence H-D-L-S-E-A-L-K-E-A-T-K-E-V-H-C-NH2 corresponding to amino acid residues [12-25] + Cys-NH2 of the human HO-1 protein (Yoshida et al. -
Add to Cart The item has been addedMABX8281-1KCANTI-HEPATITIS B E ANTIGEN (HBEAG) (1MG) (C005B-448154)
Price: $1,537.60List Price: $1,708.44General description Native HBeAg Quality Detect HBeAg using mouse monoclonal Anti-HBeAg, Cat No MABX8281-1KC, validated for use in ELISA Physical form Purified mouse monoclonal antibody in buffer containing 10 mM Tris-HCl, pH 8.0, 0. -
Add to Cart The item has been addedAV32903-100ULANTI-HIF1AN
Price: $825.16List Price: $916.84Immunogen Synthetic peptide directed towards the N terminal region of human HIF1AN Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper) -
Add to Cart The item has been addedSAB2107601-100ULANTI-HPRT
Price: $1,022.07List Price: $1,135.63Immunogen The immunogen for anti-HPRT antibody: synthetic peptide derected towards the C terminal of human HPRT Sequence Synthetic peptide located within the following region: SRSVGYRPDFVGFEIPDKFVVGYALDYNEYFRDLNHVCVISETGKAKYKA Physical form -
Add to Cart The item has been addedST1529-100UGANTI-HTT MOUSE MAB (3F1) 1PC X 100UG
Price: $910.70List Price: $1,011.89General description Purified mouse monoclonal antibody. Recognizes the ~50 kDa HTT protein. -
Add to Cart The item has been addedMAB2168ANTI-HUNTINGTIN PROTEIN ANTIBODY A.A. 2146-2541 CLONE HU-2E8
Price: $1,196.31List Price: $1,329.23Specificity Reacts with Huntingtin protein from human and monkey. Weak to no reactivity with mouse. -
Add to Cart The item has been added05-554-25UGANTI-KDR/FLK-1/VEGFR2 ANTIBODY CLONE CH (C005B-244005)
Price: $372.25List Price: $413.61Specificity KDR/Flk-1 Immunogen Recombinant protein corresponding to residues 1158-1345 of murine KDR/Flk-1 Application Anti-KDR/Flk-1/VEGFR2 Antibody, clone CH-11 detects level of KDR/Flk-1/VEGFR2 &: has been published &: validated for -
Add to Cart The item has been added05-554ANTI-KDR/FLK-1/VEGFR2 ANTIBODY CLONE CH-11 (C005B-244004)
Price: $932.26List Price: $1,035.84Specificity KDR/Flk-1 Immunogen Recombinant protein corresponding to residues 1158-1345 of murine KDR/Flk-1 Application Anti-KDR/Flk-1/VEGFR2 Antibody, clone CH-11 detects level of KDR/Flk-1/VEGFR2 &: has been published &: validated for -
Add to Cart The item has been added05-852ANTI-M-CADHERIN ANTIBODY CLONE 12G4
Price: $971.78List Price: $1,079.75Specificity M-Cadherin Immunogen Recombinant extracellular domain of mouse M-Cadherin Application Anti-M-Cadherin Antibody, clone 12G4 is an antibody against M-Cadherin for use in ELISA, WB &: IC. Research Category Cell Structure Research -
Add to Cart The item has been added07-189ANTI-NOTCH 4 ANTIBODY
Price: $855.02List Price: $950.02Specificity truncated, intracellular domain of Int3/Notch 4, possibly full-length Notch 4: does not cross-react with Notch 1, 2 or 3 Immunogen His-tag fusion protein containing the carboxy-terminus of murine Notch 4 Application Anti-Notch 4 -
Add to Cart The item has been added07-543ANTI-P19 ARF ANTIBODY
Price: $880.17List Price: $977.96Specificity p19 ARF Immunogen Full length mouse p19 ARF fused to GST. Application Detect p19 ARF with Anti-p19 ARF Antibody (Rabbit Polyclonal Antibody), that has been shown to work in IP &: WB. -
Add to Cart The item has been added07-002ANTI-P67-PHOX ANTIBODY
Price: $1,040.03List Price: $1,155.59Specificity p67-phox Immunogen GST fusion protein corresponding to full-length human p67-phox. Application Research Category Neuroscience Research Sub Category Oxidative Stress This Anti-p67-phox Antibody is validated for use in IP, WB, IC
Hemlock allergenic extracts
Browse our curated selection of Hemlock allergenic extracts from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Hemlock allergenic extracts
Cenmed Enterprises provides a comprehensive selection of Hemlock allergenic extracts products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.