Maple allergenic extracts

&#945-Amylase is also referred as taka-amylase A. We are committed to bringing you&nbspGreener&nbspAlternative Products, which adhere to one or more of The 12 Principles of&nbspGreener&nbspChemistry.

&#945-Amylase is also referred as taka-amylase A. We are committed to bringing you&nbspGreener&nbspAlternative Products, which adhere to one or more of The 12 Principles of&nbspGreener&nbspChemistry.

Anti-Caspase 8 antibody, Mouse monoclonal (mouse IgM isotype) is derived from the CAS8 hybridoma produced by the fusion of mouse myeloma cells and splenocytes from a BALB/c mouse immunized with a recombinant human caspase 8. Caspase 8 gene is

Specificity Daxx Immunogen GST fusion protein corresponding to residues 472-740 of human Daxx. Application Anti-Daxx Antibody is an antibody against Daxx for use in IP, WB &amp: IC.

General description The branched-chain alpha-keto acid dehydrogenase complex (BCKD) is an inner-mitochondrial enzyme complex involved in the breakdown of the branched-chain amino acids isoleucine, leucine, and valine. The BCKD complex is thought

Immunogen Synthetic peptide directed towards the N terminal region of human FOXA1 Sequence Synthetic peptide located within the following region: MLGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNSGLGSMNSMNTYMTM Physical form Purified antibody supplied in

Immunogen Synthetic peptide directed towards the N terminal region of human FOXC1 Biochem/physiol Actions FOXC1 belongs to the forkhead family of transcription factors which is characterized by a distinct DNA-binding forkhead domain. The

Immunogen Synthetic peptide directed towards the middle region of human FOXM1 Biochem/physiol Actions This protein acts as a Transcriptional activatory factor. May play a role in the control of cell proliferation.

Immunogen Synthetic peptide directed towards the middle region of human FOXO4 Sequence Synthetic peptide located within the following region: YLYQILQGIVFCHSRRVLHRDLKPQNLLIDDKGTIKLADFGLARAFGIPI Physical form Purified antibody supplied in 1x

Specificity ORC6 Immunogen Full-length human origin recognition complex 6 (ORC6). Clone 3A4.

ANTI-PCYT1A ANTIBODY CLONE 1D9L4 RABBIT MONOCLONAL

Anti-TEX9 testis expressed 9, 25ul UN 1687 6.1 PG2