-
Add to Cart The item has been addedHPA027440-100ULANTI-C8ORF48 (C005B-207172)
Price: $959.88List Price: $1,066.53The gene encoding chromosome 8 open reading frame 48 (C8orf48) is localized on human chromosome 8p22. Immunogen Uncharacterized protein C8orf48 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas -
Add to Cart The item has been addedHPA044805-100ULANTI-C8ORF59 (C005B-213717)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 8 open reading frame 59 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA071903-100ULANTI-C8ORF59 (C005B-221352)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 8 open reading frame 59 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA025066-100ULANTI-C8ORF86 (C005B-206632)
Price: $959.88List Price: $1,066.53The gene C8orf86 (chromosome 8 open reading frame 86) is mapped to human chromosome 8p11.22. -
Add to Cart The item has been addedHPA065287-100ULANTI-C9ORF116 (C005B-220103)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to chromosome 9 open reading frame 116 Sequence MAEECPRACAEPVAPKATAPPERTSDYYRVSADLPGRFNNPGWFRGYRTQKAVSVYRTSN Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
Add to Cart The item has been addedHPA020725-100ULANTI-C9ORF16 (C005B-205426)
Price: $959.88List Price: $1,066.53Changes in the expression of C9orf16 (chromosome 9 open reading frame 16) may be linked to metastatic lung cancer. Immunogen UPF0184 protein C9orf16 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by -
Add to Cart The item has been addedHPA021200-100ULANTI-C9ORF172 (C005B-205544)
Price: $959.88List Price: $1,066.53The gene C9orf172 (chromosome 9 open reading frame 172) is mapped to human chromosome 9. It encodes for an uncharacterized protein. -
Add to Cart The item has been addedHPA053008-100ULANTI-C9ORF24 ANTIBODY PRODUCED IN RABBIT
Price: $1,013.20List Price: $1,125.78Ciliated bronchial epithelium 1 (CBE1) or C9ORF24 expression is induced during bronchial epithelial cell differentiation. It is localized in the nuclear or perinuclear areas of the cell. -
Add to Cart The item has been addedHPA072729-100ULANTI-C9ORF3 (C005B-221493)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 9 open reading frame 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA026743-100ULANTI-C9ORF50 (C005B-206871)
Price: $959.88List Price: $1,066.53Chromosome 9 open reading frame 50 (C9orf50) is one among the new genes identified on chromosome 9. Proteogenomic analysis states that C9orf50 mRNA is expressed mainly in normal adult pancreas. -
Add to Cart The item has been addedHPA054903-100ULANTI-C9ORF64 ANTIBODY PRODUCED IN RABBIT (C005B-217154)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 9 open reading frame 64 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
Add to Cart The item has been addedHPA066190-100ULANTI-C9ORF64 (C005B-220292)
Price: $1,013.20List Price: $1,125.78Immunogen chromosome 9 open reading frame 64 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
