Nuclear matrix protein 22 tests

Coronin actin binding protein, 2B (CORO2B) belongs to the coronin-like protein (Clipin) family and is a type II coronin isoform. It is expressed in the brain, and possesses a WD domain and an &#945-helical region.

Immunogen Cytochrome c oxidase polypeptide 8 isoform 3, mitochondrial precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen cramped chromatin regulator homolog 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to cysteine rich secretory protein 1 Sequence TSYPVSWSSVIGVWYSESTSFKHGEWTTTDDDITTDHYTQIVWATSYLIGCAIASCRQQGSPRY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated

Immunogen Recombinant protein corresponding to crystallin beta A1 Sequence METQAEQQELETLPTTKMAQTNPTPGSLGPWKITIYDQENFQGKRMEFTSSCPNVSERSFDNVRSLKVES Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the

The gene CRYM (&#956-crystallin) is mapped to human chromosome 16p. CRYM is also referred as THBP (NADP-regulated thyroid-hormone-binding protein).

The gene CRYZ (crystallin &#950) is mapped to human chromosome 1p31. It belongs to the quinone oxidoreductase (QOR) family.

Immunogen cysteine-serine-rich nuclear protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cysteine-serine-rich nuclear protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

CTIF (CBP80/20-dependent translation initiation factor) is a novel perinuclear region localized protein consisting of a MIF4G (middle domain of eIF4GI) domain. Immunogen Uncharacterized protein KIAA0427 recombinant protein epitope signature tag

The gene CTIF (cap binding complex dependent translation initiation factor) is mapped to human chromosome 18q21.1.

Immunogen CTP synthase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the