-
Add to Cart The item has been added9103Anti-SARS-CoV-2 (COVID-19) Nucleocapsid, 0.1mg (C003B-211849)
Price: $1,173.02List Price: $1,303.36Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been added9091Anti-SARS-CoV-2 (COVID-19) Spike, 0.1mg (C003B-211846)
Price: $1,173.02List Price: $1,303.36Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been added9095Anti-SARS-CoV-2 (COVID-19) Spike, 0.1mg (C003B-211847)
Price: $1,173.02List Price: $1,303.36Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been addedHPA018248-100ULANTI-SMARCB1 (C005B-204761)
Price: $1,101.69List Price: $1,224.10The gene SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1) is mapped to human chromosome 22q11.23. -
Add to Cart The item has been addedSAB1300018-100UGANTI-SNK (C-TERM) ANTIBODY PRODUCED IN RABBIT
Price: $876.57List Price: $973.97General description Plks (polo-like kinases) encode serine/threonine kinases that are closely related to polo and CDC5, genes that are required for passage through mitosis in Drosophila and Saccharomyces, respectively. Polo-like kinases, which -
Add to Cart The item has been addedSAB1411302-100UGANTI-SNRPA ANTIBODY PRODUCED IN RABBIT
Price: $976.72List Price: $1,085.24Immunogen SNRPA (NP_004587.1, 1 a. -
Add to Cart The item has been addedHPA003482-100ULANTI-SNRPN (C005B-201998)
Price: $1,101.69List Price: $1,224.10Immunogen small nuclear ribonucleoprotein polypeptides B and B1 recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. -
Add to Cart The item has been addedHPA015605-100ULANTI-SNX10 (C005B-204202)
Price: $1,210.58List Price: $1,345.09Immunogen Sorting nexin-10 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the -
Add to Cart The item has been addedMABT1538-25ULANTI-SNX9 CLONE 6C6 (C005B-448535)
Price: $366.52List Price: $407.25General description Sorting nexin-9 (UniProt: Q9Y5X1: also known as SH3 and PX domain-containing protein 1, Protein SDP1, SH3 and PX domain-containing protein 3A, SNX9) is encoded by the SNX9 (also known as SH3PX1, SH3PXD3A) gene (Gene ID: 51429) -
Add to Cart The item has been addedMABT1538-100ULANTI-SNX9 CLONE 6C6 (C005B-448536)
Price: $871.19List Price: $967.98General description Sorting nexin-9 (UniProt: Q9Y5X1: also known as SH3 and PX domain-containing protein 1, Protein SDP1, SH3 and PX domain-containing protein 3A, SNX9) is encoded by the SNX9 (also known as SH3PX1, SH3PXD3A) gene (Gene ID: 51429) -
Add to Cart The item has been addedHPA039789-100ULANTI-SSSCA1 ANTIBODY PRODUCED IN RABBIT (C005B-211401)
Price: $1,101.69List Price: $1,224.10Immunogen Sjogren syndrome/scleroderma autoantigen 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA064670-100ULANTI-SSSCA1 (C005B-219941)
Price: $1,101.69List Price: $1,224.10Immunogen Recombinant protein corresponding to Sjogren syndrome/scleroderma autoantigen 1 Sequence VMACTQTALLQKLTWASAELGSSTSLETSIQLCGLIRACAEALRSLQQLQH Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by
