-
Add to Cart The item has been addedHPA006997-100ULANTI-S100A7 (C005B-202719)
Price: $959.88List Price: $1,066.53S100A7 (S100 calcium binding protein A7) is Ca 2+ -binding protein associated with the various cellular and extracellular activities. It is expressed in the ear, skin, tongue and stratified squamous epithelial tissues. -
Add to Cart The item has been addedHPA055873-100ULANTI-S100G ANTIBODY PRODUCED IN RABBIT (C005B-217478)
Price: $1,013.20List Price: $1,125.78Immunogen S100 calcium binding protein G Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA028920-100ULANTI-S100G ANTIBODY PRODUCED IN RABBIT (C005B-207709)
Price: $1,066.53List Price: $1,185.03Immunogen S100 calcium binding protein G Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA019502-100ULANTI-S100P (C005B-205096)
Price: $959.88List Price: $1,066.53S100P (S100 calcium binding protein P) is a calcium binding protein belonging to the S100 gene family. It is expressed in the human placenta. -
Add to Cart The item has been addedHPA075251-100ULANTI-S100P ANTIBODY PRODUCED IN RABBIT (C005B-221916)
Price: $1,066.53List Price: $1,185.03Immunogen S100 calcium binding protein P Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA051929-100ULANTI-S100Z (C005B-216199)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to S100 calcium binding protein Z Sequence MPTQLEMAMDTMIRIFHRYSGKARKRFKLS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been added9099Anti-SARS-CoV-2 (COVID-19) Nucleocapsid, 0.1mg (C003B-211848)
Price: $678.84List Price: $754.26Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been added9103Anti-SARS-CoV-2 (COVID-19) Nucleocapsid, 0.1mg (C003B-211849)
Price: $678.84List Price: $754.26Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been added9091Anti-SARS-CoV-2 (COVID-19) Spike, 0.1mg (C003B-211846)
Price: $678.84List Price: $754.26Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been added9095Anti-SARS-CoV-2 (COVID-19) Spike, 0.1mg (C003B-211847)
Price: $678.84List Price: $754.26Anti-SARS-CoV-2 (COVID-19) Spike S1, 0.1mg / 9083 HOST SPECIES: Rabbit CLONALITY: Polyclonal TESTED APPLICATIONS: ELISA, WB APPLICATIONS: SARS-CoV-2 (COVID-19, 2019-nCoV) Spike antibody can be used for the detection of SARS-CoV-2 (COVID-19, -
Add to Cart The item has been addedHPA018248-100ULANTI-SMARCB1 (C005B-204761)
Price: $959.88List Price: $1,066.53The gene SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily B member 1 (SMARCB1) is mapped to human chromosome 22q11.23. -
Add to Cart The item has been addedSAB1300018-100UGANTI-SNK (C-TERM) ANTIBODY PRODUCED IN RABBIT
Price: $825.16List Price: $916.84General description Plks (polo-like kinases) encode serine/threonine kinases that are closely related to polo and CDC5, genes that are required for passage through mitosis in Drosophila and Saccharomyces, respectively. Polo-like kinases, which
