-
Add to Cart The item has been addedFCMAB141A4MILLI-MARK(TM) ANTI-SSEA3 ALEXA 488 ANTIBODY CLONE MC-631
Price: $771.36List Price: $857.07The cell-surface markers used routinely to identify undifferentiated human embryonic stem cells (hESCs) were initially characterized as markers for mESCs, mouse embryonic carcinomas (ECs), or human EC cells. Stage-specific embryonic antigen-3 -
Add to Cart The item has been addedSAB4700159-100TSTMONOCLONAL ANTI-CD34-PE ANTIBODY PRODUCED IN MOUSE (C005B-321770)
Price: $836.38List Price: $929.31General description CD34 may serve as a biomarker for aggressive cervical squamous cell carcinoma. Immunogen Human endothelial vesicles Application The reagent is designed for Flow Cytometry analysis of human blood cells using 20 μ:L -
Add to Cart The item has been addedAMAB90865-100ULMONOCLONAL ANTI-CDH1 ANTIBODY PRODUCED IN MOUSE (C005B-242357)
Price: $1,066.53List Price: $1,185.03Immunogen cadherin 1, type 1, E-cadherin (epithelial) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedAMAB91129-100ULMONOCLONAL ANTI-CHAT ANTIBODY PRODUCED IN MOUSE (C005B-242468)
Price: $1,066.53List Price: $1,185.03Immunogen choline O-acetyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedSAB4700670-100UGMONOCLONAL ANTI-KRT18 ANTIBODY PRODUCED IN MOUSE (C005B-321481)
Price: $558.77List Price: $620.86General description The antibody DC-10 reacts with Cytokeratin 18 (45 kDa). Cytokeratins are a member of intermediate filaments subfamily represented in epithelial tissues. -
Add to Cart The item has been addedAMAB91533-100ULMONOCLONAL ANTI-MUC1 ANTIBODY PRODUCED IN MOUSE (C005B-242664)
Price: $1,066.53List Price: $1,185.03Immunogen Recombinant protein corresponding to mucin 1, cell surface associated Sequence AVCQCRRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGNGGSSLSYTNPAVAATSANL Epitope Binds to an epitope located within the peptide sequence RRKNYGQLDIFPARD as -
Add to Cart The item has been addedAMAB91264-100ULMONOCLONAL ANTI-OTC ANTIBODY PRODUCED IN MOUSE (C005B-242527)
Price: $1,066.53List Price: $1,185.03Immunogen ornithine carbamoyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedAMAB91266-100ULMONOCLONAL ANTI-OTC ANTIBODY PRODUCED IN MOUSE (C005B-242529)
Price: $1,066.53List Price: $1,185.03Immunogen ornithine carbamoyltransferase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been added96121230-1VLPE/CA-PJ 15 HUMAN ORAL SQUAMOUS CELL CARCINOMA (C005B-238483)
Price: $1,835.55List Price: $2,039.50Cell Line Origin Human oral squamous cell carcinoma Cell Line Description The cell line PE/CA-PJ15 was established from tongue tissue of a 45 year old male patient with oral squamous cell carcinoma. The cells have been shown to have epithelial -
Add to Cart The item has been addedAb120149-100μlRecombinant pan Cytokeratin Antibody (C007B-437592)
Price: $426.41List Price: $473.78Mouse anti Human pan Cytokeratin Antibody, Recombinant (AE1/AE3), could be used for IHC and so on.Application:IHC: 1/50-1/100:Relevance:Cytokeratins, a group comprising at least 29 different proteins, are characteristic of epithelial and trichocytic -
Add to Cart The item has been addedAb120149-10μlRecombinant pan Cytokeratin Antibody (C007B-437593)
Price: $120.98List Price: $134.42Mouse anti Human pan Cytokeratin Antibody, Recombinant (AE1/AE3), could be used for IHC and so on.Application:IHC: 1/50-1/100:Relevance:Cytokeratins, a group comprising at least 29 different proteins, are characteristic of epithelial and trichocytic -
Add to Cart The item has been addedAb120149-1mlRecombinant pan Cytokeratin Antibody (C007B-437594)
Price: $1,580.96List Price: $1,756.62Mouse anti Human pan Cytokeratin Antibody, Recombinant (AE1/AE3), could be used for IHC and so on.Application:IHC: 1/50-1/100:Relevance:Cytokeratins, a group comprising at least 29 different proteins, are characteristic of epithelial and trichocytic
