Immunology

Immunogen ARL11 (NP_612459.1, 1 a.

Anti-ARL15 Antibody has been tested for use in ELISA, Western Blotting, and Immunohistochemistry. Specific conditions for reactivity should be optimized by the end user.

Immunogen Peptide with sequence C-LDDISSRIFTAD from the C Terminus of the protein sequence according to NP_001658. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence GNGLSDQTSILSN-C from the N Terminus of the protein sequence according to NP_005729. Features and Benefits Evaluate our antibodies with complete peace of mind.

Immunogen Peptide with sequence CKQDQPGALSAAEVEKR, from the internal region of the protein sequence according to NP_001652.2.

Immunogen ARL6IP4 (NP_061164.2, 1 a.

Immunogen ARL6IP4 (NP_061164.2, 1 a.

Immunogen ARL6IP6 (NP_689735.1, 1 a.

General description ADP-ribosylation factor-like 7 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL7 is closely similar to ARL4 and ARL6 and each has a nuclear localization signal and an unusually high guanine

General description ADP-ribosylation factor-like 7 is a member of the ADP-ribosylation factor family of GTP-binding proteins. ARL7 is closely similar to ARL4 and ARL6 and each has a nuclear localization signal and an unusually high guanine

Immunogen Synthetic peptide directed towards the middle region of human ARL8B Sequence Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL Physical form Purified antibody supplied in 1x

Hamster Secondary Antibody conjugated to alkaline phosphatase is available in a variety of formats. Anti-IgG Secondary Antibody is suitable for western blot, ELISA and immunohistochemistry as well as other antibody based assays requiring lot-to-lot