-
Add to Cart The item has been addedSAB2106054-100ULANTI-ARL8B
Price: $980.46List Price: $1,089.40Immunogen Synthetic peptide directed towards the middle region of human ARL8B Sequence Synthetic peptide located within the following region: DIGGQPRFRSMWERYCRGVNAIVYMIDAADREKIEASRNELHNLLDKPQL Physical form Purified antibody supplied in 1x -
Add to Cart The item has been added619-105-002Anti-ARMENIAN HAMSTER IgG (H&L) (GOAT) Antibody Alkaline Phosphatase Conjugated, 1mg, Liquid (sterile filtered)
Price: $520.89List Price: $578.76Hamster Secondary Antibody conjugated to alkaline phosphatase is available in a variety of formats. Anti-IgG Secondary Antibody is suitable for western blot, ELISA and immunohistochemistry as well as other antibody based assays requiring lot-to-lot -
Add to Cart The item has been added619-106-002Anti-ARMENIAN HAMSTER IgG (H&L) (GOAT) Antibody Biotin Conjugated, 1mg, Lyophilized
Price: $406.80List Price: $452.00Biotin Anti-Hamster IgG Secondary Antibody is designed for Western Blotting, ELISA and Immunohistochemistry. Biotin conjugated secondary antibodies can also be used for a variety of other applications such as Assay Development. -
Add to Cart The item has been added619-102-002Anti-ARMENIAN HAMSTER IgG (H&L) (GOAT) Antibody Fluorescein Conjugated, 1mg, Lyophilized
Price: $376.69List Price: $418.54FITC Anti-Hamster IgG Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor imaging, -
Add to Cart The item has been added619-103-002Anti-ARMENIAN HAMSTER IgG (H&L) (GOAT) Antibody Peroxidase Conjugated, 1mg, Lyophilized
Price: $452.02List Price: $502.24Anti-Hamster IgG HRP Secondary Antibody is designed for Western Blotting, ELISA and Immunohistochemistry. HRP conjugated secondary antibodies can also be used for a variety of other applications such as Assay Development. -
Add to Cart The item has been added619-109-002Anti-ARMENIAN HAMSTER IgG (H&L) (GOAT) Antibody Texas Red Conjugated, 1mg, Lyophilized
Price: $406.80List Price: $452.00Texas Red Anti-Hamster IgG Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. This product is also suitable for multiplex analysis, including multicolor -
Add to Cart The item has been added119-101-002Anti-ARMENIAN HAMSTER IgG (H&L) (GOAT) Antibody, 2mL, Lyophilized
Price: $342.92List Price: $381.03Secondary antibody to hamster IgG is available in a variety of formats. Anti-IgG Secondary Antibody is suitable for western blot, ELISA, ChIP and immunohistochemistry as well as other antibody based assays requiring lot-to-lot consistency. -
Add to Cart The item has been addedABN160ANTI-ARMS2 ANTIBODY (C005B-241199)
Price: $903.85List Price: $1,004.28Age-related maculopathy susceptibility protein 2 (ARMS2) is highly expressed in the human placenta and retina. The biological function of ARMS2 has not been fully characterized. -
Add to Cart The item has been addedSAB2500109-100UGANTI-ARNO/CYTOHESIN 2 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence EDGVYEPPDLTP-C from the N Terminus of the protein sequence according to NP_004219.2: NP_059431. -
Add to Cart The item has been addedZRB1800-4X25ULANTI-ARNT CLONE 1H2 ZOOMAB RABBIT MONOCLONAL (C005B-261251)
Price: $888.77List Price: $987.53General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and -
Add to Cart The item has been addedZRB1800-25ULANTI-ARNT CLONE 1H2 ZOOMAB RABBIT MONOCLONAL (C005B-261252)
Price: $457.36List Price: $508.17General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and -
Add to Cart The item has been addedSAB2500111-100UGANTI-ARP1 HOMOLOG A ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-YEEDGARSIHRKT from the C Terminus of the protein sequence according to NP_005727.1.
