-
Add to Cart The item has been added600-401-Z45Anti-BCL6 (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-BCL6 Antibody has been tested for use in ELISA and Western Blotting. Specific conditions for reactivity should be optimized by the end user. Expect a band at approximately 79 kDa in Western Blots of specific cell lysates and tissues. -
Add to Cart The item has been addedHPA075112-100ULANTI-BCL6B (C005B-221889)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to B-cell CLL/lymphoma 6B Sequence YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA049370-100ULANTI-BCL9L ANTIBODY PRODUCED IN RABBIT (C005B-215294)
Price: $1,013.20List Price: $1,125.78BCL9L (B cell CLL/lymphoma 9 like) belongs to legless protein family. It is located on chromosome 11q23. -
Add to Cart The item has been added600-401-Z46Anti-BCL9L (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-Bcl9L Antibody has been tested for use in ELISA, Western Blotting, Immunocytochemistry. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been added600-401-Z51Anti-BCMA (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-BCMA Antibody has been tested for use in ELISA, Western Blotting, Immunohistochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedSAB1302441-400ULANTI-BCMO1 (CENTER)
Price: $900.00List Price: $1,000.00Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been addedHPA056308-100ULANTI-BCOR (C005B-217620)
Price: $1,013.20List Price: $1,125.78Immunogen BCL6 corepressor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA073591-100ULANTI-BCOR (C005B-221619)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to BCL6 corepressor Sequence LRVDRKRKVSGDSSHTETTAEEVPEDPLLKAKRRRVSKDDWPEREMTNSSSNHLEDPHYSELTNLKVCIELTGLHPKKQRHLLHLRERWEQQVSAADGKPG Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedSAB1412876-50UGANTI-BCORL1 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40Immunogen BCORL1 (AAI56743.1, 1 a. -
Add to Cart The item has been addedSAB4502658-100UGANTI-BCR ANTIBODY PRODUCED IN RABBIT (C005B-323484)
Price: $946.78List Price: $1,051.98General description Anti-BCR Antibody detects endogenous levels of total BCR protein. Immunogen The antiserum was produced against synthesized peptide derived from human Bcr. -
Add to Cart The item has been addedSAB4502657-100UGANTI-BCR ANTIBODY PRODUCED IN RABBIT (C005B-323485)
Price: $946.78List Price: $1,051.98General description Anti-BCR Antibody detects endogenous levels of total BCR protein. Immunogen The antiserum was produced against synthesized peptide derived from human Bcr. -
Add to Cart The item has been addedZRB1217-4X25ULANTI-BCRP (ABCG2) CLONE 10K5 ZOOMAB RABBIT MONOCLONAL (C005B-262165)
Price: $871.00List Price: $967.78General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and
