Immunology

Bone morphogenetic protein 15 (BMP15), also known as Growth/differentiation factor 9B (GDF9B), is part of the transforming growth factor-beta (TGF-&#946) superfamily. BMP15 is an oocyte-specific growth and differentiation factor that stimulates

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description We are committed to bringing you greener alternative products, which adhere to one or more of The 12 Principles of Green Chemistry.This antibody is Preservative-free, produced without the harm or sacrifice of animals and

General description The protein encoded by this gene is a member of the TGF-beta family of growth factors. Data suggest that the similar protein in mouse plays an important role in trabeculation of the embryonic heart.

ANTI-BMP6 ANTIBODY CLONE 6N5S9 RABBIT MONOCLONAL

General description BMS1L may act as a molecular switch during maturation of the 40S ribosomal subunit in the nucleolus. Immunogen BMS1L (NP_055568, 1-30) This antibody is generated from rabbits immunized with a KLH conjugated synthetic peptide

Immunogen Recombinant protein corresponding to basonuclin 1 Sequence EKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen Recombinant protein corresponding to basonuclin 2 Sequence STQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPKSSFRIHRMRRMGSASRKGRVFCNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen BOC cell adhesion associated, oncogene regulated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen BOC cell adhesion associated, oncogene regulated Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive