Immunology

Specificity The antibody detects endogenous levels of total BTN2A2 protein. Immunogen Fusion protein corresponding to a region derived from internal residues of human butyrophilin, subfamily 2, member A2 Features and Benefits Evaluate our

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

Immunogen BTN3A3 (AAH15815, 1 a.a.

Immunogen BTNL3 (NP_932079.1, 1 a.

Immunogen Synthetic peptide directed towards the N terminal region of human BTNL8 Application Anti-BTNL8 antibody produced in rabbit is suitable for western blotting at a concentration of 0.5&#956g/ml.

Immunogen Synthetic peptide directed towards the N terminal region of human BTNL9 Sequence Synthetic peptide located within the following region: EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL Physical form Purified antibody supplied in

Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide.

This protein A purified antibody has been tested for use in immunoprecipitation, immunofluorescence staining and western blot and is capable of detecting endogenous protein.  Specific conditions for reactivity should be optimized by the end user.

General description Anti-BUB1B Antibody detects endogenous levels of total BUB1B protein. Immunogen The antiserum was produced against synthesized peptide derived from human BUB1B.

Anti-Bub3 Antibody has been tested for use in ELISA, Western Blotting, Immunocytochemistry and Immunofluorescence. Specific conditions for reactivity should be optimized by the end user.

This protein A purified antibody has been tested for use in immunoprecipitation, immunofluorescence staining and western blot and is capable of detecting endogenous protein.  Specific conditions for reactivity should be optimized by the end user.

BVES (blood vessel epicardial substance) is the prototypic member of Popeye Domain Containing (Popdc) family, and is also called POPDC1. This family has two other members called POPDC2 and POPDC3.