Antibody Labeling and Modification Kits

Immunogen CEACAM21 (AAH12001.1, 1 a.

CEACAM5 (Carcinoembryonic antigen-related cell adhesion molecule 5) is a cell surface glycoprotein belonging to the membrane-bound immunoglobulin superfamily (IgSF). It is expressed in human airways.

ANTI-CEACAM6 ANTIBODY CLONE 4Z3V7 RABBIT MONOCLONAL

ANTI-CENPC ANTIBODY CLONE 5E3K5 RABBIT MONOCLONAL

Immunogen ceramide synthase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen cilia and flagella associated protein 45 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cilia and flagella associated protein 45 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen Recombinant protein corresponding to cilia and flagella associated protein 53 Sequence QETRTILQKALQERIEHIQQEYRDEQDLNMKLVQRALQDLQEEADKKKQKREDMIREQKIYHKYLAQRREEEKAQEKEFDRILEEDKAKKLAEKD Application All Prestige Antibodies Powered by Atlas

Immunogen Peptide with sequence C-KYIQERHGDSLKKE from the internal region of the protein sequence according to NP_006593.2.

Anti-ChAT antibody is suitable for use in ELISA, Western Blotting and IHC. Specific conditions for reactivity should be optimized by the end user.

Immunogen Peptide with sequence C-NKDGVLVDEFGLPQ from the C Terminus of the protein sequence according to NP_057494.2.

Immunogen Peptide with sequence C-HVDRYFTQKEET, from the internal region of the protein sequence according toNP_000736.2 Features and Benefits Evaluate our antibodies with complete peace of mind.