-
Add to Cart The item has been added200-4697SAnti-AVIDIN (Egg White) (RABBIT) Antibody Biotin Conjugated, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86Suitable for immunoblotting, ELISA, immunohistochemistry, immunomicroscopy as well as other antibody based assays using streptavidin or avidin conjugates requiring lot-to-lot consistency. -
Add to Cart The item has been added200-4197-0100Anti-AVIDIN (Egg White) (RABBIT) Antibody, 100 g, Lyophilized
Price: $1,007.43List Price: $1,119.37Anti-AVIDIN is suitable for ELISA, Western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been added200-4197SAnti-AVIDIN (Egg White) (RABBIT) Antibody, 25 L, Liquid (sterile filtered)
Price: $399.48List Price: $443.86Anti-AVIDIN is suitable for ELISA, Western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been addedB9655-.5MLANTI-AVIDIN ANTIBODY MOUSE MONOCLONAL BIOTIN CONJUGATE
Price: $567.62List Price: $630.69Avidin is a glycoprotein (68 kDa) composed of four identical polypeptides chains isolated from egg whites.Monoclonal Anti-Avidin (mouse IgG1 isotype) is derived from the hybridoma produced by the fusion of mouse myeloma cells and splenocytes from -
Add to Cart The item has been addedSAB2500141-100UGANTI-B7-H4 ANTIBODY PRODUCED IN GOAT
Price: $1,128.05List Price: $1,253.39General description V-set domain containing T cell activation inhibitor 1 (VTCN1), also known as B7-H4, is a co-stimulating molecule. It is part of the B7 superfamily and the gene encoding it is localized on human chromosome 1p13. -
Add to Cart The item has been addedSAB2108341-100ULANTI-CDH23 (C005B-330351)
Price: $1,041.83List Price: $1,157.59Immunogen Synthetic peptide directed towards the middle region of human CDH23 Biochem/physiol Actions This gene is a member of the cadherin superfamily, whose genes encode calcium dependent cell-cell adhesion glycoproteins. The encoded protein -
Add to Cart The item has been addedSAB2107836-100ULANTI-CRISP3 (C005B-476174)
Price: $958.19List Price: $1,064.66Immunogen The immunogen for anti-CRISP3 antibody: synthetic peptide derected towards the N terminal of human CRISP3 Sequence Synthetic peptide located within the following region: PVLLFLVAGLLPSFPANEDKDPAFTALLTTQTQVQREIVNKHNELRRAVS Physical -
Add to Cart The item has been addedSAB1406633-50UGANTI-CSDE1 (C005B-335839)
Price: $976.72List Price: $1,085.24Immunogen CSDE1 (NP_009089.4, 1 a. -
Add to Cart The item has been addedAV35127-100ULANTI-CUL5 (C005B-098760)
Price: $880.17List Price: $977.96Cul5- part of the Cullin family of proteins. It exhibits anti-proliferative characteristics due to its function in the Ring E3 ligase complex of the ubquitin system. -
Add to Cart The item has been addedSAB1405682-50UGANTI-CX3CR1
Price: $1,041.83List Price: $1,157.59Immunogen CX3CR1 (NP_001328.1, 1 a. -
Add to Cart The item has been addedSAB1302459-400ULANTI-DROSOPHILA PARKIN (N-TERM) (C005B-340956)
Price: $955.61List Price: $1,061.79Physical form Purified polyclonal antibody supplied in PBS with 0.09% (W/V) sodium azide. -
Add to Cart The item has been added200-4669-0100Anti-ESTERASE (RABBIT) Antibody Biotin Conjugated, 100 g, Lyophilized
Price: $1,443.47List Price: $1,603.86Anti-Esterase has been assayed against 1.0 ug of Esterase in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2'-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes a
Avidin/Streptavidin Biotin Products
Browse our curated selection of Avidin/Streptavidin Biotin Products from leading global manufacturers. Find research-grade reagents, certified standards, and specialty supplies backed by Cenmed's expert sourcing and technical support.
Related Categories
About Avidin/Streptavidin Biotin Products
Cenmed Enterprises provides a comprehensive selection of Avidin/Streptavidin Biotin Products products sourced from leading global manufacturers. Our catalog spans research-grade reagents, certified standards, and specialty compounds used across clinical, academic, and industrial laboratories worldwide.
With decades of expertise in laboratory supply distribution, we offer competitive pricing, reliable stock availability, and dedicated technical support. Whether you need small quantities for research or bulk orders for manufacturing, our team is ready to assist with sourcing, compliance documentation, and logistics.