Avidin/Streptavidin Biotin Products

General description This gene belongs to the hyaluronan and proteoglycan binding link protein gene family. The protein encoded by this gene may function in hyaluronic acid binding and cell adhesion.

Immunogen Synthetic peptide of human hyperpolarization activated cyclic nucleotide gated potassium channel 4 Features and Benefits Evaluate our antibodies with complete peace of mind. If the antibody does not perform in your application, we will

Anti-HIVEP3 human immunodeficiency virus type I enhancer bin

Anti-HYPM huntingtin interacting protein M, 25ul UN 1687 6.1

Immunogen Synthetic peptide directed towards the N terminal region of human KIAA1333 Biochem/physiol Actions KIAA1333 is a probable E3 ubiquitin-protein ligase which accepts ubiquitin from an E2 ubiquitin-conjugating enzyme in the form of a

Suitable for immunoblotting, ELISA, immunohistochemistry, immunomicroscopy as well as other antibody based assays using streptavidin or avidin conjugates requiring lot-to-lot consistency.

Suitable for immunoblotting, ELISA, immunohistochemistry, immunomicroscopy as well as other antibody based assays using streptavidin or avidin conjugates requiring lot-to-lot consistency.

Suitable for immunoblotting, ELISA, immunohistochemistry, immunomicroscopy as well as other antibody based assays using streptavidin or avidin conjugates requiring lot-to-lot consistency.

Anti-PGAP3 post-GPI attachment to proteins 3, 100ul UN 1687

Anti-PNISR PNN-interacting serine/arginine-rich protein, 25u

Immunogen Synthetic peptide directed towards the middle region of human POSTN Biochem/physiol Actions POSTN binds to heparin. It induces cell attachment and spreading and plays a role in cell adhesion.

Immunogen Synthetic peptide directed towards the middle region of human RASSF7 Sequence Synthetic peptide located within the following region: DISIPDYCSLGDGEEEEITINAWFGPQGTISPLHQDPQQNFLVQVMGRKY Physical form Purified antibody supplied in 1x