Immunoglobulin Conjugates

Immunogen Synthetic peptide directed towards the N terminal region of human CTRL Sequence Synthetic peptide located within the following region: SQSWVVTAAHCNVSPGRHFVVLGEYDRSSNAEPLQVLSVSRAITHPSWNS Physical form Purified antibody supplied in 1x PBS

Immunogen Synthetic peptide directed towards the middle region of human CXorf34 Application Anti-CXORF34 antibody produced in rabbit is suitable for western blotting at a concentration of 2.5&#956g/ml.

Specificity Human cystic fibrosis transmembrane conductance regulator (CFTR). Recognizes an epitope at the cytoplasmic region preceding the first nucleotide binding domain between residues 386 to 412.

General description This gene encodes a nuclear protein that is involved in V(D)J recombination and DNA repair. The protein has single-strand-specific 5&#8242:-3&#8242: exonuclease activity: it also exhibits endonuclease activity on 5&#8242: and

Specificity The antibody reacts with desmin from human, pig, rat and taod. In tissue sections this antibody is used to stain skeletal, cardiac, visceral, and some vascular smooth muscle cells.

Desmin is an intermediate filament protein found mainly in skeletal, cardiac, and smooth muscle cells. It acts as a marker for tumor origin.

Desmin is an intermediate filament protein found mainly in skeletal, cardiac, and smooth muscle cells. It acts as a marker for tumor origin.

General description DHX37 is a DEAD box protein. DEAD box proteins, characterized by the conserved motif Asp-Glu-Ala-Asp (DEAD), are putative RNA helicases.

Anti-DIP2B disco-interacting protein 2 homolog B, 100ul UN 1

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Dog IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Dog IgG coupled to agarose beads. Assay by immunoelectrophoresis resulted in a single precipitin arc against Anti-Rabbit Serum, Dog IgG, Dog

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Dog IgG coupled to agarose beads. Assay by immunoelectrophoresis resulted in a single precipitin arc against Anti-Biotin, Anti-Goat Serum, Dog