Immunohistochemistry Reagents

Application For use as a rinse buffer in Immunohistochemical staining procedures after dilution (see preparation below). Use prepared 1X Rinse Buffer at room temperature.

30% H2O2 Solution reagent is specifically designed for the use in Rockland MaxTagâ„¢ Histo for Immunohistochemistry Kit.

Sepax SRT SEC columns feature a hydrophilic surface layer that effectively shields the highly porous, five micron silica particles from interacting with your sample. SRT columns are employed in the quality control of biotherapeutics by gel

Sepax SRT SEC columns feature a hydrophilic surface layer that effectively shields the highly porous, five micron silica particles from interacting with your sample. SRT columns are employed in the quality control of biotherapeutics by gel

Sepax SRT SEC columns feature a hydrophilic surface layer that effectively shields the highly porous, five micron silica particles from interacting with your sample. SRT columns are employed in the quality control of biotherapeutics by gel

Immunogen Synthetic peptide directed towards the N terminal region of human BTNL9 Sequence Synthetic peptide located within the following region: EIRWFRSQTFNVVHLYQEQQELPGRQMPAFRNRTKLVKDDIAYGSVVLQL Physical form Purified antibody supplied in

Immunogen Synthetic peptide, CPTSQGRSPAGPTVVSI-amide, from C-terminal region of human (DbetaH). Application Immunoblotting: 1:250-1:1,000 on human, monkey and bovine adrenal medulla.

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Guinea Pig IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Guinea Pig IgG coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by

Specificity This product was prepared from monospecific antiserum by immunoaffinity chromatography using Human IgM coupled to agarose beads followed by solid phase adsorption(s) to remove any unwanted reactivities. Assay by immunoelectrophoresis

This product has been assayed against 1.0 ug of Human IgA in a standard capture ELISA using Peroxidase Conjugated Streptavidin #S000-03 and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid]) code # ABTS-100 as a substrate for 30 minutes a

General description Anti-MMP23 (Cleaved-Tyr 79 ) Antibody detects endogenous levels of fragment of activated MMP23 (Cleaved-Tyr 79 ) protein. Immunogen The antiserum was produced against synthesized peptide derived from human MMP23.