-
Add to Cart The item has been addedSAB1400769-50UGANTI-NY-SAR-48 ANTIBODY PRODUCED IN MOUSE
Price: $980.46List Price: $1,089.40Immunogen NY-SAR-48 (AAH10176, 1 a.a. -
Add to Cart The item has been addedSAB5702979-100ULANTI-OLIG2 ANTIBODY CLONE 1P8G4 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-OLIG2 ANTIBODY CLONE 1P8G4 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB5702580-100ULANTI-P47PHOX/NCF1 ANTIBODY CLONE 8J2F6 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-P47PHOX/NCF1 ANTIBODY CLONE 8J2F6 RABBIT MONOCLONAL -
Add to Cart The item has been added600-401-H09Anti-p53DINP1 (RABBIT) Antibody, 100 g, Liquid (sterile filtered)
Price: $962.05List Price: $1,068.95Anti-P53dinp1 Antibody is suitable for use in E,WB, and IHC. Expect a band approximately ~27. -
Add to Cart The item has been addedSAB5702105-100ULANTI-P75NTR/NGFR ANTIBODY CLONE 2H6Q6 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-P75NTR/NGFR ANTIBODY CLONE 2H6Q6 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB3501285-100UGANTI-PACS1 ANTIBODY PRODUCED IN RABBIT (C15-1740-607)
Price: $780.44List Price: $867.15General description The phosphofurin acidic cluster sorting protein 1 (PACS1), belongs to the PACS family of cytosolic connector proteins that localize different membrane proteins to the trans-Golgi network (TGN) (1,2). Mutations in PACS1 cause -
Add to Cart The item has been addedHPA077892-100ULANTI-PACS2 (C15-1467-104)
Price: $1,013.20List Price: $1,125.78Immunogen phosphofurin acidic cluster sorting protein 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB5702433-100ULANTI-PAR4 ANTIBODY CLONE 10Q2G9 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-PAR4 ANTIBODY CLONE 10Q2G9 RABBIT MONOCLONAL -
Add to Cart The item has been addedSAB5702581-100ULANTI-PARP2 ANTIBODY CLONE 6G5U7 RABBIT MONOCLONAL
Price: $727.80List Price: $808.67ANTI-PARP2 ANTIBODY CLONE 6G5U7 RABBIT MONOCLONAL -
Add to Cart The item has been addedHPA070751-100ULANTI-PAX2 (C15-1465-901)
Price: $1,013.20List Price: $1,125.78Immunogen paired box 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA069000-100ULANTI-PAX3 (C15-1465-583)
Price: $1,013.20List Price: $1,125.78Immunogen paired box 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The -
Add to Cart The item has been addedHPA010580-100ULANTI-PCDHGA2 (C15-1447-395)
Price: $959.88List Price: $1,066.53Immunogen Recombinant protein corresponding to protocadherin gamma subfamily A, 2 Sequence PNTDWRFSQAQRPGTSGSQNGDDTGTWPNNQFDTEMLQAMILASASEAADGSSTLGGGAGTMGLSARYGPQFTLQHVPDYRQNVYIPGSNATLTNAAGKRDGKAPAGGNGNKKKSGKKEK Application All Prestige Antibodies
