Primary Antibodies

Anti-ATG8 antibody is suitable for use in IHC (p) and WB. Expect a band approximately 16 kDa on specific lysates. Specific conditions for reactivity should be optimized by the end user.

Immunogen ATPase H+/K+ transporting alpha subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

AXL (receptor tyrosine kinase) is also termed as Ark, UFO or Tyro7. This gene is overexpressed in pancreatic cancer tissues.

Immunogen beta-1,3-N-acetylgalactosaminyltransferase 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen UDP-Gal:betaGlcNAc beta 1,3-galactosyltransferase, polypeptide 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas

Immunogen Peptide with sequence C-NAWKQNLNKVKN from the C Terminus of the protein sequence according to NP_006351.2.

Anti-Bacteriophage M13 Antibody has been tested in ELISA. Expect a band at ~3.6 kDa in western blot using appropriate lysates or tissues.

Anti-Bacteriophage M13 Antibody has been tested in ELISA.&nbsp Expect a band at ~3.6 kDa in western blot using appropriate lysates or tissues.

Anti-BAFF Antibody is suitable for use in E,WB, and ICC. Expect a band approximately ~31.2 kDa on specific lysates. Specific conditions for reactivity should be optimized by the end user.

Anti-Bassoon Antibody is suitable for use in WB and IHC. Expect a band approximately ~420kDa on specific lysates corresponding to the molecular mass of Bassoon.

Immunogen B cell CLL/lymphoma 11A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to B-cell CLL/lymphoma 6B Sequence YLQMEHVVQACHRFIQASYEPLGISLRPLEAEPPTPPTAP Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)