-
HPA074738-100ULANTI-BIRC6 (C005B-221823)
Price: $1,013.20List Price: $1,125.78Immunogen baculoviral IAP repeat containing 6 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA047850-100ULANTI-BIRC7 (C005B-214762)
Price: $1,013.20List Price: $1,125.78Immunogen baculoviral IAP repeat containing 7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
200-301-E94Anti-BK Beta 4 (MOUSE) Monoclonal Antibody, 100 g, Liquid (sterile filtered)
Price: $982.28List Price: $1,091.43Anti-BK Beta4 Antibody is suitable for use in WB, IP, IF, and IHC. Antibody is provided in PBS pH 7.4. Expect a band approximately ~24kDa on specific lysates. Specific conditions for reactivity should be optimized by the end user. -
HPA077428-100ULANTI-BNC1 (C005B-222244)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to basonuclin 1 Sequence EKEAVEIANEKRHNLSSDEDMPLQVVSEDEQEACSPQSHRVSEEQHVQSGGLGKPFPEGERPCHRESVIESSG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA059419-100ULANTI-BNC2 (C005B-218536)
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to basonuclin 2 Sequence STQNEYNESSESEVSPTPYKNDQTPNRNALTSITNVEPKTEPACVSPIQNSAPVSDLTKTEHPKSSFRIHRMRRMGSASRKGRVFCNA Application All Prestige Antibodies Powered by Atlas Antibodies are developed and -
HPA045380-100ULANTI-BOLA2 ANTIBODY PRODUCED IN RABBIT (C005B-213915)
Price: $1,013.20List Price: $1,125.78Immunogen bolA family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA046696-100ULANTI-BOLA2 ANTIBODY PRODUCED IN RABBIT (C005B-214356)
Price: $1,013.20List Price: $1,125.78Immunogen bolA family member 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA046393-100ULANTI-BOLA3 ANTIBODY PRODUCED IN RABBIT (C005B-214250)
Price: $1,066.53List Price: $1,185.03Immunogen bolA family member 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA048335-100ULANTI-BSPH1
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to binder of sperm protein homolog 1 Sequence SACIFPVILNELSSTVETITHFPEVTDGECVFPFHYKNGTYYDCIKSKARHKWCSLNKTY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by -
HPA061334-100ULANTI-BTBD11 ANTIBODY PRODUCED IN RABBIT
Price: $1,066.53List Price: $1,185.03Immunogen BTB domain containing 11 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA057157-100ULANTI-BTG4 (C005B-217877)
Price: $1,013.20List Price: $1,125.78Immunogen B-cell translocation gene 4 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
HPA001198-100ULANTI-BTK (C005B-201288)
Price: $959.88List Price: $1,066.53Immunogen Tyrosine-protein kinase BTK recombinant protein epitope signature tag (PrEST) Application Anti-BTK antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is



