-
Add to Cart The item has been addedHPA047614-100ULANTI-CEP19 ANTIBODY PRODUCED IN RABBIT (C005B-214687)
Price: $1,013.20List Price: $1,125.78Immunogen centrosomal protein 19kDa recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA051595-100ULANTI-CERCAM (C005B-216082)
Price: $1,013.20List Price: $1,125.78Immunogen cerebral endothelial cell adhesion molecule Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedSAB2500230-100UGANTI-CES1 ANTIBODY PRODUCED IN GOAT
Price: $1,062.79List Price: $1,180.87Immunogen Peptide with sequence C-NTQAAQKLKDKE from the internal region (near C terminus) of the protein sequence according to NP_001020366.1: NP_001020365. -
Add to Cart The item has been addedHPA070304-100ULANTI-CFAP70
Price: $1,013.20List Price: $1,125.78Immunogen Recombinant protein corresponding to cilia and flagella associated protein 70 Sequence DLKGFKGDTPVTFIRAEFNQVVLGDSAKITVSPEGSAKYNFTSSFEFNPEGGITSDDLAHKPVFLTVTEVLPKEKKQKE Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been added100-401-D16Anti-ChAT (Choline Acetyltransferase) (Rabbit) Antibody, 100 L, Liquid
Price: $962.05List Price: $1,068.95Anti-ChAT antibody is suitable for use in ELISA, Western Blotting and IHC. Specific conditions for reactivity should be optimized by the end user. -
Add to Cart The item has been addedHPA027407-100ULANTI-CHCHD2 ANTIBODY PRODUCED IN RABBIT (C005B-207155)
Price: $959.88List Price: $1,066.53Immunogen coiled-coil-helix-coiled-coil-helix domain containing 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project -
Add to Cart The item has been added603-101-126Anti-CHICKEN IgG (H&L) (GOAT) Antibody (Min X Bv Gt GP Ham Hs Hu Ms Rb Rt & Sh Serum Proteins), 1mg, Liquid (sterile filtered)
Price: $342.92List Price: $381.03Anti-Chicken IgG antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been added603-101-002Anti-CHICKEN IgG (H&L) (GOAT) Antibody, 2mg, Liquid (sterile filtered)
Price: $342.92List Price: $381.03Anti-Chicken IgG antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been added203-4102Anti-CHICKEN IgG (H&L) (RABBIT) Antibody, 50mg, Lyophilized
Price: $962.05List Price: $1,068.95Anti-Chicken IgG antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been added603-4103Anti-CHICKEN IgG F(c) (RABBIT) Antibody, 2mg, Liquid (sterile filtered)
Price: $350.84List Price: $389.83Anti-Chicken IgG F(c) antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been added603-101-007Anti-CHICKEN IgM (mu chain) (GOAT) Antibody, 1mg, Liquid (sterile filtered)
Price: $383.13List Price: $425.70Anti-Chicken IgM antibody is suitable for ELISA, western blot, and immunohistochemistry, as well as other assays requiring lot-to-lot consistency. -
Add to Cart The item has been added203-401-C41Anti-Chicken Interferon Gamma (RABBIT) Antibody, 100 g, Lyophilized
Price: $868.42List Price: $964.91This protein A purified antibody is suitable for ELISA and Western blotting. Specific conditions for reactivity should be optimized by the end user.
