Protein G Products

Immunogen synthetic peptide corresponding to amino acids 39-53 of rat GABA A receptor (&#9472 subunit). The sequence is identical in human, mouse, and bovine.

Immunogen synthetic peptide corresponding to amino acids 39-53 of rat GABA A receptor (&#9472 subunit). The sequence is identical in human, mouse, and bovine.

General description This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is

General description This gene encodes one of three GA-binding protein transcription factor subunits which functions as a DNA-binding subunit. Since this subunit shares identity with a subunit encoding the nuclear respiratory factor 2 gene, it is

General description This gene encodes the GA-binding protein transcription factor, beta subunit. This protein forms a tetrameric complex with the alpha subunit, and stimulates transcription of target genes.

General description Anti-GAD1 antibody detects endogenous levels of total GAD1 protein. GAD1 gene (glutamate decarboxylase 1) codes for a glutamic acid decarboxylase enzyme (GAD67), that is of 67&#160:kDa.

Growth arrest and DNA damage inducible protein 153, C/EBP homology protein (GADD153/CHOP10) is a basic region leucine zipper transcription factor, devoid of DNA binding site. Its apparent molecular mass is 29 kDa (or 19 kDa calculated).

This antibody has been tested for use in ELISA, western blotting and immunoprecipitation.  Reactivity in other immunoassays is unknown.

General description GTPase-activating protein and VPS9 domain-containing protein 1 (GAPVD1) also called Rab5-activating protein 6 (RAP6) or Gapex-5 gene is mapped to the human chromosome 9q33.3.

Immunogen GAS2L2 (NP_644814.1, 1 a.

Immunogen Synthetic peptide directed towards the N terminal region of human GATA1 Sequence Synthetic peptide located within the following region: SGPEGLDAAASSTAPSTATAAAAALAYYRDAEAYRHSPVFQVYPLLNCME Physical form Purified antibody supplied in

Immunogen GBA2 (NP_065995.1, 1 a.