Protein Expression

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) To be used in conjunction with Cayman&rsquos EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during

Antigen: human EP4 receptor C-terminal amino acids 459-488 Host: rabbit Cross Reactivity: (+) human, mouse, ovine, and rat EP4 receptors (&minus) EP1, EP2, and EP3 receptors Application(s): ICC, IHC, and WB Binding of PGE2 to the EP4 receptor

Antigen: human EP4 receptor C-terminal amino acids 459-488 Host: rabbit Cross Reactivity: (+) human, mouse, ovine, and rat EP4 receptors (&minus) EP1, EP2, and EP3 receptors Application(s): FC and IF Binding of PGE2 to the EP4 receptor causes an

Peptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI) To be used in conjunction with Cayman&rsquos EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody complex formation during analysis for the EP4 receptor.

Antigen: human EP4 receptor N-terminal amino acids 1-22 Host: rabbit Cross Reactivity: (+) human and ovine EP4 receptors Application(s): WB Binding of PGE2 to the EP4 receptor causes an increase in intracellular cAMP and subsequent relaxation of

EGF, Epidermal Growth Factor, human: Human Epidermal Growth Factor &nbspEGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor

EGF, Epidermal Growth Factor, human: Human Epidermal Growth Factor &nbspEGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor

EGF, Epidermal Growth Factor, human: Human Epidermal Growth Factor &nbspEGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor

EGF, Epidermal Growth Factor, murine (mouse): EGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth

EGF, Epidermal Growth Factor, murine (mouse): EGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth

EGF, Epidermal Growth Factor, murine (mouse): EGF was originally discovered in crude preparations of nerve growth factor prepared from mouse submaxillary glands as an activity that induced early eyelid opening, incisor eruption, hair growth

EGF, Epidermal Growth Factor, rat: EGF is a potent growth factor that stimulates the proliferation of various epidermal and epithelial cells. Additionally, EGF has been shown to inhibit gastric secretion, and to be involved in wound healing.