Antibodies

Antigen: human EP1 receptor C-terminal amino acids 380-402 Host: rabbit Application(s): ICC and WB Binding of PGE2 to the EP1 receptor results in an increase in phosphatidyl inositol turnover with subsequent increase in intracellular free Ca2+.

Peptide Sequence: human EP2 receptor amino acids 335-358 (SLRTQDATQTSCSTQSDASKQADL) To be used in conjunction with Cayman&rsquos EP2 receptor polyclonal antibody (Catalog No. 101750) to block protein-antibody complex formation during immunochemical

Antigen: synthetic peptide from human EP2 receptor C-terminal amino acids 335-358 Host: rabbit Cross Reactivity: (+) human, mouse, and rat EP2 receptors (&minus) EP1, EP3, and EP4 receptors Application(s): ICC and WB Binding of PGE2 to the EP2

Antigen: human EP2 receptor amino acids 335-358 Host: rabbit Cross-Reactivity: (+) human, mouse, and rat EP2 receptors (&minus) EP1, EP3, and EP4 receptors Application(s): FC and ICC

Peptide Sequence: human EP3 receptor sequence amino acids 308-327 (NQTSVEHCKTHTEKQKECNF) To be used in conjunction with Cayman&rsquos EP3 receptor polyclonal antibody (Catalog No. 101760) to block protein-antibody complex formation during

Immunogen: Synthetic peptide from an internal region of human EP3 receptor conjugated to KLH Host: rabbit Cross Reactivity: (+) human, bovine, mouse, and rat EP3 receptors (&minus) EP1, EP2, and EP4 receptors Application(s): ICC and WB As a result

Peptide Sequence: human EP4 receptor sequence amino acids 459-488 (GSGRAGPAPKGSSLQVTFPSETLNLSEKCI) To be used in conjunction with Cayman&rsquos EP4 receptor polyclonal antibody (Catalog No. 101775) to block protein-antibody complex formation during

Antigen: human EP4 receptor C-terminal amino acids 459-488 Host: rabbit Cross Reactivity: (+) human, mouse, ovine, and rat EP4 receptors (&minus) EP1, EP2, and EP3 receptors Application(s): ICC, IHC, and WB Binding of PGE2 to the EP4 receptor

Antigen: human EP4 receptor C-terminal amino acids 459-488 Host: rabbit Cross Reactivity: (+) human, mouse, ovine, and rat EP4 receptors (&minus) EP1, EP2, and EP3 receptors Application(s): FC and IF Binding of PGE2 to the EP4 receptor causes an

Peptide Sequence: human amino acids 1-23 (MSTPGVNSSASLSPDRLNSPVTI) To be used in conjunction with Cayman&rsquos EP4 receptor polyclonal antiserum (Catalog No. 101770) to block protein-antibody complex formation during analysis for the EP4 receptor.

Antigen: human EP4 receptor N-terminal amino acids 1-22 Host: rabbit Cross Reactivity: (+) human and ovine EP4 receptors Application(s): WB Binding of PGE2 to the EP4 receptor causes an increase in intracellular cAMP and subsequent relaxation of

Antigen: phosphopeptide corresponding to amino acid residues surrounding the phospho-Thr202 and phospho-Tyr204 of rat ERK/MAPK Host: rabbit Cross Reactivity: (+) human and rat ERK/MAPK Application(s): WB ERK/MAPK is an integral component of cellular