Measuring and Observing and Testing Equipment

ACE gene codes for angiotensin-converting enzyme (ACE). It is the main enzyme in the RAS (renin angiotensin system).

Immunogen angiotensin I converting enzyme Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in

Immunogen Recombinant protein corresponding to alkaline ceramidase 3 Sequence DREGYWGPTTSTLDWCEENYSVTWYIAEFWNTVSNLIMIIPPMFGAVQSVRDGLEKR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the &#8242beads on

Histone H3 is one of the five main histone proteins involved in the structure of chromatin in eukaryotic cells. Featuring a main globular domain and a long N-terminal tail, H3 is involved with the structure of the nucleosomes of the &#8242beads on

Anti-Acetyl &amp Phospho Histone H3 [Ac-Lys9, pSer10] is developed in rabbit using a synthetic, acetylated and phosphorylated [Ac-Lys, pSer10] histone H3 peptide (amino acids 7-20) corresponding to the N-terminus of human histone H3 conjugated to

Immunogen acetylcholinesterase (Yt blood group) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

ACIN1 (apoptotic chromatin condensation inducer 1) in the nucleus is a protein encoded by the ACIN1 gene in humans. It is also known as Acinus.

Immunogen Synthetic peptide directed towards the N terminal region of human ACP1 Biochem/physiol Actions ACP1 belongs to the phosphotyrosine protein phosphatase family of proteins. It functions as an acid phosphatase and a protein tyrosine

Immunogen Low molecular weight phosphotyrosine protein phosphatase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

ACPP (acid phosphatase, prostate) is produced by the epithelial cells of human prostate gland under androgen regulation. The phosphate ions bind tightly within the active site by hydrogen bonding.

Immunogen acid phosphatase, prostate Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the