Measuring and Observing and Testing Equipment

Immunogen Adenylate cyclase type 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen Recombinant protein corresponding to ADCYAP receptor type I Sequence KKEQAMCLEKIQRANELMGFNDSSPGCPGMWDNITCWKPAHVGEMVLVSCPELFRSFNPDQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen adenylate cyclase activating polypeptide 1 (pituitary) receptor type I recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen adducin 3 (gamma) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.

Immunogen adhesion G protein-coupled receptor G7 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen alcohol dehydrogenase 1A (class I), alpha polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Immunogen alcohol dehydrogenase 1A (class I), alpha polypeptide Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most

Alcohol dehydrogenase-1B (ADH2) is an enzyme that metabolized a variety of substrates including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Alcohol dehydrogenase-1B is important in studies on alcoholism.

Alcohol dehydrogenase 4 is an enzyme that metabolized a variety of substrates including ethanol, retinol, aliphatic alcohols, hydroxysteroids, and lipid peroxidation products. Alcohol dehydrogenase 4 is found in the liver.

Immunogen Alcohol dehydrogenase 4 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported

Immunogen adrenomedullin Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

ADNP (activity-dependent neuroprotector homeobox) was initially identified as a vasoactive intestinal peptide (VIP) responsive gene in P19 carcinoma cells of mouse. This gene is localized to human chromosome 20q13.