-
HPA039963-100ULImmunogen adaptor-related protein complex 4, sigma 1 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and
-
HPA055768-100UL
Sigma-Aldrich
Anti-AP5M1 antibody produced in rabbit (C15-1462-118)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 5, mu 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA057098-100UL
Sigma-Aldrich
Anti-AP5M1 antibody produced in rabbit (C15-1462-555)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 5, mu 1 subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA043533-100UL
Sigma-Aldrich
Anti-AP5S1 antibody produced in rabbit (C15-1457-740)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to adaptor related protein complex 5 sigma 1 subunit Sequence ENLLLAEGTLRLLTRLLLDHLRLLAPSTSLLLRADRIEGILTRFLPHGQLLFLNDQFVQGLEKEFSAAW Application All Prestige Antibodies Powered by Atlas Antibodies are -
HPA048244-100UL
Sigma-Aldrich
Anti-AP5S1 antibody produced in rabbit (C15-1459-508)
Price: $928.29List Price: $1,031.43Immunogen adaptor-related protein complex 5, sigma 1 subunit recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and -
HPA038521-100UL
Sigma-Aldrich
Anti-APBB1 antibody produced in rabbit (C15-1455-296)
Price: $928.29List Price: $1,031.43Immunogen amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA038522-100UL
Sigma-Aldrich
Anti-APBB1 antibody produced in rabbit (C15-1455-297)
Price: $928.29List Price: $1,031.43Immunogen amyloid beta (A4) precursor protein-binding, family B, member 1 (Fe65) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by -
HPA053294-100ULImmunogen amyloid P component, serum Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA029396-100UL
Sigma-Aldrich
Anti-APLF antibody produced in rabbit (C15-1452-244)
Price: $879.43List Price: $977.14Immunogen aprataxin and PNKP like factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA034642-100UL
Sigma-Aldrich
Anti-APLF antibody produced in rabbit (C15-1453-491)
Price: $889.20List Price: $988.00Immunogen aprataxin and PNKP like factor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
HPA034643-100UL
Sigma-Aldrich
Anti-APLF antibody produced in rabbit (C15-1453-492)
Price: $889.20List Price: $988.00Immunogen aprataxin and PNKP like factor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
HPA028970-100UL
Sigma-Aldrich
Anti-APLP1 antibody produced in rabbit (C15-1452-074)
Price: $879.43List Price: $977.14Immunogen amyloid beta (A4) precursor-like protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive