-
Add to Cart The item has been addedA6104-25ULSigma-Aldrich
Anti-ARP2 antibody, Mouse monoclonal (C15-1315-324)
Price: $319.59List Price: $355.10ARP2 is part of a complex with 7 subunits called ARP2/3. ARP2 is an actin-related protein that function to regulate the actin cytoskeleton. -
Add to Cart The item has been addedHPA004334-100ULImmunogen Actin-related protein 2/3 complex subunit 1A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
Add to Cart The item has been addedHPA040513-100ULSigma-Aldrich
Anti-ARPIN antibody produced in rabbit (C15-1456-239)
Price: $977.14List Price: $1,085.71Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA047173-100ULSigma-Aldrich
Anti-ARPIN antibody produced in rabbit (C15-1459-161)
Price: $928.29List Price: $1,031.43Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA052278-100ULSigma-Aldrich
Anti-ARPIN antibody produced in rabbit (C15-1460-967)
Price: $928.29List Price: $1,031.43Immunogen actin-related protein 2/3 complex inhibitor Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA056851-100ULImmunogen cAMP-regulated phosphoprotein, 19kDa Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
Add to Cart The item has been addedHPA063129-100ULImmunogen Recombinant protein corresponding to arrestin 3 Sequence KDLYVQTLQVVPAESSSPQGPLTVLQERLLHKLGDNAYPFTLQMVTNLPCSVT Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) -
Add to Cart The item has been addedHPA049318-100ULSigma-Aldrich
Anti-ARRB1 antibody produced in rabbit (C15-1459-894)
Price: $977.14List Price: $1,085.71Immunogen arrestin, beta 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA070249-100ULSigma-Aldrich
Anti-ARRB1 antibody produced in rabbit (C15-1465-811)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to arrestin beta 1 Sequence LKGMKDDKEEEEDGTGSPQLNNR Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
Add to Cart The item has been addedAV48007-100ULSigma-Aldrich
Anti-ARRB2 antibody produced in rabbit (C15-1341-658)
Price: $898.29List Price: $998.10Arrestin, β 2 (ARRB2), belongs to the arrestin family and suppresses cellular responses by desensitization of G-protein coupled receptor (GPCR). It also blocks β-adrenergic-mediated functions. -
Add to Cart The item has been addedHPA065681-100ULSigma-Aldrich
Anti-ARRB2 antibody produced in rabbit (C15-1464-932)
Price: $928.29List Price: $1,031.43Immunogen arrestin, beta 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
Add to Cart The item has been addedHPA075177-100ULSigma-Aldrich
ANTI-ARRB2 ANTIBODY PRODUCED IN RABBIT (C15-1466-686)
Price: $977.14List Price: $1,085.71Immunogen arrestin beta 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry.
