-
HPA075302-100UL
Sigma-Aldrich
Anti-ATL2 antibody produced in rabbit (C15-1466-711)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to atlastin GTPase 2 Sequence RTSDPSAAVNHVSSTTSLGENYEDDDLVNSDEVMKKPCPVQIVLAHEDDHNFELDEEALEQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein -
HPA065702-100UL
Sigma-Aldrich
Anti-ATL3 antibody produced in rabbit (C15-1464-939)
Price: $928.29List Price: $1,031.43Immunogen atlastin GTPase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. -
HPA076616-100UL
Sigma-Aldrich
Anti-ATL3 antibody produced in rabbit (C15-1466-917)
Price: $928.29List Price: $1,031.43Immunogen Recombinant protein corresponding to atlastin GTPase 3 Sequence NLAAAASAKDIYYNNMEEVCGGEKPYLSPDILEEKHCEFKQLALDHFKKTKKMGGKDFSFRYQQ Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human -
HPA067142-100ULImmunogen ATM serine/threonine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA031619-100ULImmunogen atrophin 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most
-
HPA049400-100ULImmunogen atonal bHLH transcription factor 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization
-
AV39728-100UL
Sigma-Aldrich
Anti-ATOH8 antibody produced in rabbit (C15-1341-179)
Price: $759.43List Price: $843.81Atonal homolog 8 (Drosophila) (ATOH8) is a basic helix-loop-helix (bHLH) transcription factor involved in the vertebrae tissue-specific differentiation of the nervous system, kidneys, pancreas, retina and muscle during embryogenesis. Specificity -
HPA028406-100UL
Sigma-Aldrich
Anti-ATOH8 antibody produced in rabbit (C15-1451-814)
Price: $879.43List Price: $977.14Immunogen atonal bHLH transcription factor 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization -
HPA035630-100ULImmunogen ATPase, class II, type 9A recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA054320-100ULImmunogen ATR serine/threonine kinase Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the
-
HPA051353-100ULImmunogen chromosome 2 open reading frame 28 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA047590-100ULImmunogen ATR interacting protein Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the