-
Add to Cart The item has been addedHPA011089-100ULSigma-Aldrich
Anti-CA4 antibody produced in rabbit (C15-1447-525)
Price: $879.43List Price: $977.14CA4 (carbonic anhydrase IV) is a member of zinc metalloprotein family called carbonic anhydrases, which is made of 16 members. This protein is anchored to the plasma membrane through glycosyl-phosphatiydyl-inositol (GPI) moiety. -
Add to Cart The item has been addedHPA017258-100ULSigma-Aldrich
Anti-CA4 antibody produced in rabbit (C15-1448-709)
Price: $879.43List Price: $977.14CA4 (carbonic anhydrase IV) is a 35kDa glycosylphosphatidylinositol-anchored membrane protein belonging to the zinc metalloprotein family. It is synthesized as a precursor of 312 amino acids, in endoplasmic reticulum and resides in the plasma -
Add to Cart The item has been addedHPA024748-100ULThe gene CA8 (carbonic anhydrase 8) is mapped to human chromosome 8q. It is an isozyme of α-carbonic anhydrases and is widely expressed. -
Add to Cart The item has been addedHPA055207-100ULImmunogen carbonic anhydrase IX Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the -
Add to Cart The item has been addedHPA020404-100ULSigma-Aldrich
Anti-CAAP1 antibody produced in rabbit (C15-1449-591)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C9orf82 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA024029-100ULSigma-Aldrich
Anti-CAAP1 antibody produced in rabbit (C15-1450-604)
Price: $879.43List Price: $977.14Immunogen Uncharacterized protein C9orf82 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA045954-100ULSigma-Aldrich
Anti-CAB39L antibody produced in rabbit (C15-1458-703)
Price: $928.29List Price: $1,031.43Immunogen calcium binding protein 39-like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA076632-100ULSigma-Aldrich
ANTI-CAB39L ANTIBODY PRODUCED IN RABBIT (C15-1466-919)
Price: $977.14List Price: $1,085.71Immunogen calcium binding protein 39 like Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA043296-100ULImmunogen calcineurin binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are -
Add to Cart The item has been addedHPA073649-100ULImmunogen Recombinant protein corresponding to Cdk5 and Abl enzyme substrate 1 Sequence SRGRLNSFTQGILPIAFSRPTSQNYCSLEQPGQGGSTSAFEQLQRSRRRLISQRSSLETLEDIEENAPLRRCRTLSGSPRPKN Application All Prestige Antibodies Powered by Atlas Antibodies are -
Add to Cart The item has been addedHPA052138-100ULImmunogen Cdk5 and Abl enzyme substrate 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in -
Add to Cart The item has been addedHPA051438-100ULImmunogen calcium binding protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
