-
HPA016439-100ULImmunogen calcium binding protein 7 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are
-
HPA044016-100UL
Sigma-Aldrich
Anti-CABS1 antibody produced in rabbit (C15-1457-987)
Price: $928.29List Price: $1,031.43Immunogen calcium-binding protein, spermatid-specific 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a -
HPA055352-100UL
Sigma-Aldrich
Anti-CABS1 antibody produced in rabbit (C15-1461-985)
Price: $928.29List Price: $1,031.43Immunogen calcium-binding protein, spermatid-specific 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive -
HPA068138-100ULImmunogen calcium voltage-gated channel subunit alpha1 A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA068379-100ULImmunogen Recombinant protein corresponding to calcium voltage-gated channel subunit alpha1 F Sequence SCEDLPIPGTYHRGRNSGPNRAQGSWATPPQRGRLLYAPLLLVEEGAAGEGYLGRSSGPLRTFTCLHVPGTHSDPSH Application All Prestige Antibodies Powered by Atlas Antibodies are
-
HPA048892-100UL
Sigma-Aldrich
Anti-CACNA1S antibody produced in rabbit (C15-1459-740)
Price: $928.29List Price: $1,031.43Immunogen calcium channel, voltage-dependent, L type, alpha 1S subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA056815-100UL
Sigma-Aldrich
Anti-CACNA1S antibody produced in rabbit (C15-1462-456)
Price: $928.29List Price: $1,031.43Immunogen calcium channel, voltage-dependent, L type, alpha 1S subunit Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most -
HPA041351-100ULImmunogen calcium channel, voltage-dependent, gamma subunit 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and
-
HPA042504-100UL
Sigma-Aldrich
Anti-CACTIN antibody produced in rabbit (C15-1457-240)
Price: $928.29List Price: $1,031.43Immunogen chromosome 19 open reading frame 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA042548-100UL
Sigma-Aldrich
Anti-CACTIN antibody produced in rabbit (C15-1457-258)
Price: $928.29List Price: $1,031.43Immunogen chromosome 19 open reading frame 29 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, -
HPA064453-100ULImmunogen calcitonin related polypeptide alpha Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive
-
HPA008066-100UL
Sigma-Aldrich
Anti-CALD1 antibody produced in rabbit (C15-1447-048)
Price: $879.43List Price: $977.14Immunogen Caldesmon recombinant protein epitope signature tag (PrEST) Application Anti-CALD1 antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project . Each antibody is tested by