Measuring and Observing and Testing Equipment

CHIT1 (chitinase 1) gene is localized to human chromosome 1. This protein is highly expressed in cells of innate immune system, especially on activated macrophages.

Immunogen chitinase 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen Choline kinase alpha recombinant protein epitope signature tag (PrEST) Application Applications in which this antibody has been used successfully, and the associated peer-reviewed papers, are given below. Western Blotting (1 paper)

The gene CHM (choroideremia) is mapped to human chromosome Xq21.2.

Immunogen Recombinant protein corresponding to choroideremia-like (Rab escort protein 2). Sequence VEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITYSQIVKEGRRFNIDLVS Application All Prestige Antibodies Powered by Atlas Antibodies are developed and

Immunogen choroideremia-like (Rab escort protein 2) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

Immunogen Recombinant protein corresponding to choroideremia-like (Rab escort protein 2). Sequence LEVTDVEESVEKEKYCGDKTCMHTVSDKDGDKDESKSTVEDKADEPIRNRITY Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Calcineurin homologous protein 1 (CHP1) is a myristoylated EF-hand Ca(2+)-binding protein. Its expression is localized to the plasma membrane, golgi apparatus, and the nucleus.

Immunogen Chordin-like protein 1 precursor recombinant protein epitope signature tag (PrEST) Biochem/physiol Actions Chordin-like protein 1 (CHRDL1) provokes the role of BMP4 by binding to it and inhibiting its interaction with receptors. CHRDL1

Immunogen Chordin-like protein 1 precursor recombinant protein epitope signature tag (PrEST) Application Anti-CHRDL1 antibody produced in rabbit is suitable for immunohistochemistry (formalin-fixed, paraffin-embedded sections). Anti-CHRDL1 antibody

CHRDL2 (Chordin-like 2) is a novel chordin-related gene belonging to the chordin family of proteins. It encodes a putative extracellular matrix protein consistsing of a signal peptide and three cysteine-rich (CR) domains.

Immunogen chordin like 2 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The