Measuring and Observing and Testing Equipment

Immunogen Synthetic peptide directed towards the N terminal region of human CHST1 Application Anti-CHST1 antibody produced in rabbit is suitable for western blotting at a concentration of 1.25&#956g/ml and for immunohistochemistry of

Immunogen carbohydrate (chondroitin 6) sulfotransferase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen carbohydrate (chondroitin 6) sulfotransferase 3 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Carbohydrate sulfotransferase 4 (CHST4) is an N-acetylglucosamine 6-O-sulfotransferase belonging to the novel family of carbohydrate sulfotransferases. It is highly expressed on high endothelial venules, where it is hypothesized to play an

Immunogen Carbohydrate sulfotransferase 8 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen CTF8, chromosome transmission fidelity factor 8 homolog (S. cerevisiae) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein

Immunogen chromosome transmission fidelity factor 8 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen SPFH domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a

The CILP (Cartilage intermediate layer protein 1) gene encodes a 91.5kDa protein that is expressed abundantly in intervertebral discs and its levels are increased in early osteoarthrosis cartilage.

Immunogen Recombinant protein corresponding to corepressor interacting with RBPJ, 1 Sequence SSESESNNKEKKIQRKKRKKNKCSGHNNSDSEEKDKSKKRKLHEELSSSHHNREKAKEKPRFLKHESSREDSKWSHSDSD Application All Prestige Antibodies Powered by Atlas Antibodies are

Immunogen Cbp/p300-interacting transactivator, with Glu/Asp-rich carboxy-terminal domain, 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Synthetic peptide directed towards the N terminal region of mouse CITED4 Biochem/physiol Actions Cited4 is a member of The CITED family proteins that bind to CBP/p300 transcriptional integrators through their conserved C-terminal acidic