Measuring and Observing and Testing Equipment

Carnitine O -acetyltransferase (CRAT) belongs to the carnitine acyltransferase family and is expressed in the mitochondria. It is also localized to peroxisomes.

Immunogen Carnitine O-acetyltransferase recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen DNA-directed RNA polymerase III subunit RPC9 recombinant protein epitope signature tag (PrEST) Application Anti-CRCP antibody produced in rabbit, a Prestige Antibody, is developed and validated by the Human Protein Atlas (HPA) project .

Immunogen cysteine-rich secretory protein 2 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen collapsin response mediator protein 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result,

Collapsin response mediator proteins CRMPs) consist of a family of cytosolic phosphoproteins expressed in the nervous system and involved in neuronal differentiation and axonal guidance. Application Anti-CRMP2 antibody produced in rabbit has been

Immunogen cartilage associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen cartilage associated protein recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen crystallin, alpha A Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the

Immunogen Recombinant protein corresponding to crystallin alpha A Sequence PSRLFDQFFGEGLFEYDLLPFLSSTISPYYRQSLFRTVLDSGISEVRSDRDKFVIFLDVKHFSPEDLTVKVQDDFVE Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by

Crystallin, &#945 B (CRYAB) is a molecular chaperone that holds protein in soluble aggregates. It functions as a tumor suppressor by interacting with adherens junction to inhibit the progression of nasopharyngeal carcinoma.

Immunogen crystallin, alpha B Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the