Measuring and Observing and Testing Equipment

The gene CRYM (&#956-crystallin) is mapped to human chromosome 16p. CRYM is also referred as THBP (NADP-regulated thyroid-hormone-binding protein).

Immunogen crystallin, mu Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive characterization in the industry. The

Immunogen colony stimulating factor 3 receptor (granulocyte) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cysteine-serine-rich nuclear protein 1 Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by the most extensive

Immunogen cysteine and glycine-rich protein 3 (cardiac LIM protein) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA)

Cystatin-C precursor (CST3) belongs to the cystatin family (type2) of proteins and contains 120 amino acids. The gene CST3 is located on human chromosome 20p11.

Immunogen cystatin 9 (testatin) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are supported by

CXorf61 or KKLC1 is a cancer/testis antigen that interacts with tumor-specific cytotoxic T lymphocytes in lung cancer cells. Thus, CXorf61 may be used as an immunological target for cancer therapy .

The gene CTBP1 (C-terminal-binding protein 1) is mapped to human chromosome 4p16.3.

Immunogen dullard homolog ( Xenopus laevis ) recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human Protein Atlas (HPA) project and as a result, are

Immunogen Recombinant protein corresponding to CTD nuclear envelope phosphatase 1 Sequence QIRTVIQYQTVRYDILPLSPVSRNRLAQVKRKILVLDLDETLIHSHHDG Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the Human

Immunogen CTD (carboxy-terminal domain, RNA polymerase II, polypeptide A) phosphatase, subunit 1 recombinant protein epitope signature tag (PrEST) Application All Prestige Antibodies Powered by Atlas Antibodies are developed and validated by the